Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

AT-hook-containing transcription factor

 AKNA_HUMAN              Reviewed;        1439 AA.
Q7Z591; Q05BK5; Q5T535; Q5T536; Q5T537; Q64FX6; Q64FX7; Q64FX8;
Q64FY2; Q6ZMK0; Q6ZNL2; Q6ZTX0; Q8TET1; Q8TF33; Q96RR9; Q9H7P7;
29-MAY-2007, integrated into UniProtKB/Swiss-Prot.
29-MAY-2007, sequence version 2.
25-OCT-2017, entry version 107.
RecName: Full=AT-hook-containing transcription factor;
Name=AKNA; Synonyms=KIAA1968;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 5; 6 AND 7).
PubMed=15869410; DOI=10.1089/dna.2005.24.325;
Sims-Mourtada J.C., Bruce S., McKeller M.R., Rangel R.,
Guzman-Rojas L., Cain K., Lopez C., Zimonjic D.B., Popescu N.C.,
Gordon J., Wilkinson M.F., Martinez-Valdez H.;
"The human AKNA gene expresses multiple transcripts and protein
isoforms as a result of alternative promoter usage, splicing, and
polyadenylation.";
DNA Cell Biol. 24:325-338(2005).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), AND VARIANT
LEU-624.
TISSUE=Brain;
PubMed=11853319; DOI=10.1093/dnares/8.6.319;
Nagase T., Kikuno R., Ohara O.;
"Prediction of the coding sequences of unidentified human genes. XXII.
The complete sequences of 50 new cDNA clones which code for large
proteins.";
DNA Res. 8:319-327(2001).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 8), AND
VARIANTS LEU-624; GLN-1119 AND PRO-1303.
TISSUE=Spleen;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164053; DOI=10.1038/nature02465;
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
Rogers J., Dunham I.;
"DNA sequence and analysis of human chromosome 9.";
Nature 429:369-374(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), AND VARIANT
PRO-1303.
TISSUE=Eye;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
NUCLEOTIDE SEQUENCE [MRNA] OF 762-1395, FUNCTION, SUBCELLULAR
LOCATION, DNA-BINDING, AND TISSUE SPECIFICITY.
PubMed=11268217; DOI=10.1038/35066602;
Siddiqa A., Sims-Mourtada J.C., Guzman-Rojas L., Rangel R., Guret C.,
Madrid-Marina V., Sun Y., Martinez-Valdez H.;
"Regulation of CD40 and CD40 ligand by the AT-hook transcription
factor AKNA.";
Nature 410:383-387(2001).
[7]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-534 AND SER-1387, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-52; SER-316; SER-499;
SER-767; SER-770; SER-848; SER-886; SER-997; SER-1010; SER-1228;
SER-1377 AND SER-1424, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE
SCALE ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
-!- FUNCTION: Transcription factor that specifically activates the
expression of the CD40 receptor and its ligand CD40L/CD154, two
cell surface molecules on lymphocytes that are critical for
antigen-dependent-B-cell development. Binds to A/T-rich promoters.
{ECO:0000269|PubMed:11268217}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:11268217}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=8;
Name=1; Synonyms=B2, D;
IsoId=Q7Z591-1; Sequence=Displayed;
Name=2; Synonyms=E;
IsoId=Q7Z591-2; Sequence=VSP_025936;
Name=3;
IsoId=Q7Z591-3; Sequence=VSP_025939;
Name=4;
IsoId=Q7Z591-4; Sequence=VSP_025932, VSP_025940;
Note=No experimental confirmation available.;
Name=5; Synonyms=F1;
IsoId=Q7Z591-5; Sequence=VSP_025933;
Name=6;
IsoId=Q7Z591-6; Sequence=VSP_025937, VSP_025938;
Name=7; Synonyms=A;
IsoId=Q7Z591-7; Sequence=VSP_025935;
Name=8;
IsoId=Q7Z591-8; Sequence=VSP_025934;
-!- TISSUE SPECIFICITY: Predominantly expressed by lymphoid tissues.
Highly expressed in the spleen, lymph nodes and peripheral blood
leukocytes, expressed at lower level in the thymus. Mainly
expressed by germinal center B-lymphocytes, a stage in which
receptor and ligand interactions are crucial for B-lymphocyte
maturation. Expressed by B- and T-lymphocytes, Natural killer
cells and CD1a(+)CD14(-) but not CD1a(-)CD14(+) dendritic cells.
Weakly or not expressed in fetal liver and in adult bone marrow.
{ECO:0000269|PubMed:11268217}.
-!- SEQUENCE CAUTION:
Sequence=AAK83024.1; Type=Frameshift; Positions=1228; Evidence={ECO:0000305};
Sequence=AAU34192.1; Type=Frameshift; Positions=1227; Evidence={ECO:0000305};
Sequence=BAB84866.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=BAB85554.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=BAC85132.1; Type=Frameshift; Positions=1340; Evidence={ECO:0000305};
Sequence=BAD18725.1; Type=Frameshift; Positions=820, 1017, 1340, 1387, 1434; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY703039; AAU34186.1; -; mRNA.
EMBL; AY703043; AAU34190.1; -; mRNA.
EMBL; AY703044; AAU34191.1; -; mRNA.
EMBL; AY703045; AAU34192.1; ALT_FRAME; mRNA.
EMBL; AB075848; BAB85554.1; ALT_INIT; mRNA.
EMBL; AK024431; BAB15721.1; -; mRNA.
EMBL; AK074040; BAB84866.1; ALT_INIT; mRNA.
EMBL; AK131082; BAC85132.1; ALT_SEQ; mRNA.
EMBL; AK160382; BAD18725.1; ALT_SEQ; mRNA.
EMBL; AL356796; CAM23638.1; -; Genomic_DNA.
EMBL; AL356796; CAI16861.1; -; Genomic_DNA.
EMBL; AL356796; CAI16862.2; -; Genomic_DNA.
EMBL; AL356796; CAI16863.1; -; Genomic_DNA.
EMBL; BC042202; AAH42202.1; -; mRNA.
EMBL; BC055285; AAH55285.1; -; mRNA.
EMBL; AF286341; AAK83024.1; ALT_FRAME; mRNA.
CCDS; CCDS6805.1; -. [Q7Z591-1]
RefSeq; NP_001304879.1; NM_001317950.1. [Q7Z591-1]
RefSeq; NP_001304881.1; NM_001317952.1. [Q7Z591-7]
RefSeq; NP_110394.3; NM_030767.5. [Q7Z591-1]
RefSeq; XP_005252301.1; XM_005252244.2. [Q7Z591-1]
RefSeq; XP_005252302.1; XM_005252245.1. [Q7Z591-1]
RefSeq; XP_005252304.1; XM_005252247.4. [Q7Z591-1]
RefSeq; XP_006717357.1; XM_006717294.1. [Q7Z591-1]
RefSeq; XP_006717358.1; XM_006717295.2. [Q7Z591-3]
RefSeq; XP_011517365.1; XM_011519063.2. [Q7Z591-7]
RefSeq; XP_011517367.2; XM_011519065.2. [Q7Z591-7]
RefSeq; XP_016870661.1; XM_017015172.1. [Q7Z591-7]
UniGene; Hs.494895; -.
ProteinModelPortal; Q7Z591; -.
SMR; Q7Z591; -.
BioGrid; 123268; 1.
IntAct; Q7Z591; 3.
MINT; MINT-1366492; -.
STRING; 9606.ENSP00000303769; -.
iPTMnet; Q7Z591; -.
PhosphoSitePlus; Q7Z591; -.
BioMuta; AKNA; -.
DMDM; 150416853; -.
EPD; Q7Z591; -.
MaxQB; Q7Z591; -.
PaxDb; Q7Z591; -.
PeptideAtlas; Q7Z591; -.
PRIDE; Q7Z591; -.
Ensembl; ENST00000223791; ENSP00000223791; ENSG00000106948. [Q7Z591-8]
Ensembl; ENST00000307564; ENSP00000303769; ENSG00000106948. [Q7Z591-1]
Ensembl; ENST00000312033; ENSP00000309222; ENSG00000106948. [Q7Z591-3]
Ensembl; ENST00000374075; ENSP00000363188; ENSG00000106948. [Q7Z591-2]
Ensembl; ENST00000374079; ENSP00000363192; ENSG00000106948. [Q7Z591-4]
Ensembl; ENST00000374088; ENSP00000363201; ENSG00000106948. [Q7Z591-1]
GeneID; 80709; -.
KEGG; hsa:80709; -.
UCSC; uc004bio.5; human. [Q7Z591-1]
CTD; 80709; -.
DisGeNET; 80709; -.
EuPathDB; HostDB:ENSG00000106948.16; -.
GeneCards; AKNA; -.
HGNC; HGNC:24108; AKNA.
HPA; HPA052367; -.
HPA; HPA063993; -.
MIM; 605729; gene.
neXtProt; NX_Q7Z591; -.
OpenTargets; ENSG00000106948; -.
PharmGKB; PA134908332; -.
eggNOG; ENOG410IDZE; Eukaryota.
eggNOG; ENOG4111ICK; LUCA.
GeneTree; ENSGT00390000003745; -.
HOVERGEN; HBG097463; -.
InParanoid; Q7Z591; -.
KO; K21404; -.
OMA; LEEPWMA; -.
OrthoDB; EOG091G0EXN; -.
PhylomeDB; Q7Z591; -.
TreeFam; TF336885; -.
ChiTaRS; AKNA; human.
GenomeRNAi; 80709; -.
PMAP-CutDB; Q7Z591; -.
PRO; PR:Q7Z591; -.
Proteomes; UP000005640; Chromosome 9.
Bgee; ENSG00000106948; -.
Genevisible; Q7Z591; HS.
GO; GO:0005813; C:centrosome; IDA:HPA.
GO; GO:0005829; C:cytosol; IDA:HPA.
GO; GO:0001650; C:fibrillar center; IDA:HPA.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
GO; GO:0016020; C:membrane; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0000978; F:RNA polymerase II core promoter proximal region sequence-specific DNA binding; IDA:NTNU_SB.
GO; GO:0001077; F:transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding; IDA:NTNU_SB.
GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IDA:NTNU_SB.
InterPro; IPR022150; TF_AT-hook.
Pfam; PF12443; AKNA; 1.
1: Evidence at protein level;
Activator; Alternative splicing; Complete proteome; DNA-binding;
Nucleus; Phosphoprotein; Polymorphism; Reference proteome;
Transcription; Transcription regulation.
CHAIN 1 1439 AT-hook-containing transcription factor.
/FTId=PRO_0000289159.
DNA_BIND 1115 1123 A.T hook.
REGION 771 804 PEST.
REGION 911 932 PEST.
MOD_RES 52 52 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 316 316 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 499 499 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 534 534 Phosphoserine.
{ECO:0000244|PubMed:19690332}.
MOD_RES 767 767 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 770 770 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 848 848 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 886 886 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 997 997 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 1010 1010 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 1172 1172 Phosphoserine.
{ECO:0000250|UniProtKB:Q80VW7}.
MOD_RES 1173 1173 Phosphoserine.
{ECO:0000250|UniProtKB:Q80VW7}.
MOD_RES 1228 1228 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 1377 1377 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 1387 1387 Phosphoserine.
{ECO:0000244|PubMed:19690332}.
MOD_RES 1424 1424 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
VAR_SEQ 1 1055 Missing (in isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_025932.
VAR_SEQ 1 753 Missing (in isoform 5).
{ECO:0000303|PubMed:15869410}.
/FTId=VSP_025933.
VAR_SEQ 1 540 Missing (in isoform 8).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_025934.
VAR_SEQ 1 119 Missing (in isoform 7).
{ECO:0000303|PubMed:15869410}.
/FTId=VSP_025935.
VAR_SEQ 1 91 MASSETEIRWAEPGLGKGPQRRRWAWAEDKRDVDRSSSQSW
EEERLFPNATSPELLEDFRLAQQHLPPLEWDPHPQPDGHQD
SESGETSGE -> MLRSEWPVFP (in isoform 2).
{ECO:0000303|PubMed:15869410}.
/FTId=VSP_025936.
VAR_SEQ 448 572 EDYHRLLTKYAEAENTIDQLRLGAKVNLFSDPPQPNHSIHT
GMVPQGTKVLSFTIPQPRSAEWWPGPAEDPQASAASGWPSA
RGDLSPSSLTSMPTLGWLPENRDISEDQSSAEQTQALASQA
SQ -> VSGTHGCGCVTKAPVGLGWRLIGVGRPGVEAGWGG
EAWDRAWLGWEALGRRLVGWGGLGWRLARVGSPGMEASGVG
RPGVGSPGVEPGGVGRPGVEAGWGRKPWDRGWWGGEAWGGG
WLGQEALG (in isoform 6).
{ECO:0000303|PubMed:15869410}.
/FTId=VSP_025937.
VAR_SEQ 573 1439 Missing (in isoform 6).
{ECO:0000303|PubMed:15869410}.
/FTId=VSP_025938.
VAR_SEQ 832 1439 Missing (in isoform 3).
{ECO:0000303|PubMed:11853319}.
/FTId=VSP_025939.
VAR_SEQ 1056 1074 PCGPTETIPSFLLTRAGRD -> MSAGGGTRGYSPRSPGAT
S (in isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_025940.
VARIANT 624 624 P -> L (in dbSNP:rs3748176).
{ECO:0000269|PubMed:11853319,
ECO:0000269|PubMed:14702039}.
/FTId=VAR_032586.
VARIANT 1097 1097 Q -> R (in dbSNP:rs1265891).
/FTId=VAR_032587.
VARIANT 1119 1119 R -> Q (in dbSNP:rs3748178).
{ECO:0000269|PubMed:14702039}.
/FTId=VAR_032588.
VARIANT 1303 1303 S -> P (in dbSNP:rs2250242).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15489334}.
/FTId=VAR_032589.
VARIANT 1327 1327 Y -> C (in dbSNP:rs2787344).
/FTId=VAR_032590.
CONFLICT 799 799 D -> V (in Ref. 3; BAD18725/BAC85132).
{ECO:0000305}.
CONFLICT 816 816 R -> S (in Ref. 3; BAD18725).
{ECO:0000305}.
CONFLICT 1037 1037 L -> F (in Ref. 6; AAK83024).
{ECO:0000305}.
CONFLICT 1103 1103 P -> Q (in Ref. 3; BAD18725).
{ECO:0000305}.
CONFLICT 1114 1114 A -> P (in Ref. 3; BAD18725).
{ECO:0000305}.
CONFLICT 1429 1429 Q -> P (in Ref. 3; BAD18725).
{ECO:0000305}.
CONFLICT 1435 1436 GS -> AP (in Ref. 3; BAD18725).
{ECO:0000305}.
SEQUENCE 1439 AA; 155139 MW; 51688A0C5C55A7BE CRC64;
MASSETEIRW AEPGLGKGPQ RRRWAWAEDK RDVDRSSSQS WEEERLFPNA TSPELLEDFR
LAQQHLPPLE WDPHPQPDGH QDSESGETSG EEAEAEDVDS PASSHEPLAW LPQQGRQLDM
TEEEPDGTLG SLEVEEAGES SSRLGYEAGL SLEGHGNTSP MALGHGQARG WVASGEQASG
DKLSEHSEVN PSVELSPARS WSSGTVSLDH PSDSLDSTWE GETDGPQPTA LAETLPEGPS
HHLLSPDGRT GGSVARATPM EFQDSSAPPA QSPQHATDRW RRETTRFFCP QPKEHIWKQT
KTSPKPLPSR FIGSISPLNP QPRPTRQGRP LPRQGATLAG RSSSNAPKYG RGQLNYPLPD
FSKVGPRVRF PKDESYRPPK SRSHNRKPQA PARPLIFKSP AEIVQEVLLS SGEAALAKDT
PPAHPITRVP QEFQTPEQAT ELVHQLQEDY HRLLTKYAEA ENTIDQLRLG AKVNLFSDPP
QPNHSIHTGM VPQGTKVLSF TIPQPRSAEW WPGPAEDPQA SAASGWPSAR GDLSPSSLTS
MPTLGWLPEN RDISEDQSSA EQTQALASQA SQFLAKVESF ERLIQAGRLM PQDQVKGFQR
LKAAHAALEE EYLKACREQH PAQPLAGSKG TPGRFDPRRE LEAEIYRLGS CLEELKEHID
QTQQEPEPPG SDSALDSTPA LPCLHQPTHL PAPSGQAPMP AIKTSCPEPA TTTAAASTGP
CPLHVNVEVS SGNSEVEDRP QDPLARLRHK ELQMEQVYHG LMERYLSVKS LPEAMRMEEE
EEGEEEEEEE GGGDSLEVDG VAATPGKAEA TRVLPRQCPV QAEKSHGAPL EEATEKMVSM
KPPGFQASLA RDGHMSGLGK AEAAPPGPGV PPHPPGTKSA ASHQSSMTSL EGSGISERLP
QKPLHRGGGP HLEETWMASP ETDSGFVGSE TSRVSPLTQT PEHRLSHIST AGTLAQPFAA
SVPRDGASYP KARGSLIPRR ATEPSTPRSQ AQRYLSSPSG PLRQRAPNFS LERTLAAEMA
VPGSEFEGHK RISEQPLPNK TISPPPAPAP AAAPLPCGPT ETIPSFLLTR AGRDQAICEL
QEEVSRLRLR LEDSLHQPLQ GSPTRPASAF DRPARTRGRP ADSPATWGSH YGSKSTERLP
GEPRGEEQIV PPGRQRARSS SVPREVLRLS LSSESELPSL PLFSEKSKTT KDSPQAARDG
KRGVGSAGWP DRVTFRGQYT GHEYHVLSPK AVPKGNGTVS CPHCRPIRTQ DAGGAVTGDP
LGPPPADTLQ CPLCGQVGSP PEADGPGSAT SGAEKATTRR KASSTPSPKQ RSKQAGSSPR
PPPGLWYLAT APPAPAPPAF AYISSVPIMP YPPAAVYYAP AGPTSAQPAA KWPPTASPPP
ARRHRHSIQL DLGDLEELNK ALSRAVQAAE SVRSTTRQMR SSLSADLRQA HSLRGSCLF


Related products :

Catalog number Product name Quantity
E2432h Human AT Hook Containing Transcription Factor 1 EL 96T
60156 IgG,AT hook containing transcription factor 1 (AHCTF1) 0.1 mg
AKR1A1 AKNA Gene AT-hook transcription factor
E3529h Human AT Hook Transcription Factor ELISA Kit 96T
GWB-A270DD AT hook containing transcription factor 1 (AHCTF1), Antibody
AKNA_MOUSE Mouse ELISA Kit FOR AT-hook-containing transcription factor 96T
AHCYL1 AHCTF1 Gene AT hook containing transcription factor 1
CSB-EL001537MO Mouse AT-hook-containing transcription factor(AKNA) ELISA kit 96T
CSB-EL001537HU Human AT-hook-containing transcription factor(AKNA) ELISA kit 96T
CSB-EL001537MO Mouse AT-hook-containing transcription factor(AKNA) ELISA kit SpeciesMouse 96T
CSB-EL001537HU Human AT-hook-containing transcription factor(AKNA) ELISA kit SpeciesHuman 96T
CSB-EL001472HU Human AT hook containing transcription factor 1 (AHCTF1) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL001537HU Human AT-hook transcription factor (AKNA) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL001472MO Mouse AT hook containing transcription factor 1 (AHCTF1) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL001537MO Mouse AT-hook transcription factor (AKNA) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
EIAAB42084 Homo sapiens,Human,Mitochondrial transcription factor 1,MtTF1,mtTFA,TCF6,TCF-6,TCF6L2,TFAM,Transcription factor 6,Transcription factor 6-like 2,Transcription factor A, mitochondrial
18-003-42098 Ets domain transcription factor - ESE3 transcription factor; EHF protein; DJ875K15.1.2 (Ets homologous factor (Ets-domain transcription factor. ESE-3B (Isoform 2))); ETS-family transcription factor EH 0.1 mg Protein A
EIAAB42103 Immunoglobulin enhancer-binding factor E12_E47,Pan,Pancreas specific transcription factor 1c,Ptf1c,Rat,Rattus norvegicus,Tcf3,TCF-3,Tcfe2a,Transcription factor 3,Transcription factor E2-alpha,Transcri
EIAAB42104 Alf2,Immunoglobulin enhancer-binding factor E12_E47,Me2,Mouse,Mus musculus,Tcf3,TCF-3,Tcfe2a,Transcription factor 3,Transcription factor A1,Transcription factor E2-alpha
31-248 Transcription initiation factor IIA . and . chains (GTranscription Factor Antibodies2A1, Transcription Factor AntibodiesIIA p35 and p19 subunits, Transcription Factor AntibodiesIIAL) binding ability o 0.05 mg
EIAAB12871 Ahctf1,Elys,Embryonic large molecule derived from yolk sac,Mouse,Mus musculus,Protein ELYS,Protein MEL-28,Putative AT-hook-containing transcription factor 1
20-372-60156 AT hook containing transcription factor 1 (AHCTF1) - Mouse monoclonal anti-human AHCTF1 antibody; Embryonic large molecule derived from yolk sac Monoclonal 0.1 mg
EIAAB12290 E4F transcription factor 1,E4f1,Mouse,Mus musculus,p120E4F,Putative E3 ubiquitin-protein ligase E4F1,Transcription factor E4F,Transcription factor E4F1,Transcription factor phi AP3
EIAAB12870 AHCTF1,ELYS,Embryonic large molecule derived from yolk sac,Homo sapiens,Human,MSTP108,Protein ELYS,Protein MEL-28,Putative AT-hook-containing transcription factor 1,TMBS62
18-003-44075 Transcription factor E2-alpha - Immunoglobulin enhancer-binding factor E12_E47; Transcription factor 3; TCF-3; Immunoglobulin transcription factor 1; Transcription factor ITF-1; Kappa-E2-binding facto 0.1 mg Protein A


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur