Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

ATP-binding cassette sub-family G member 1 (ATP-binding cassette transporter 8) (White protein homolog)

 ABCG1_HUMAN             Reviewed;         678 AA.
P45844; Q86SU8; Q96L76; Q9BXK6; Q9BXK7; Q9BXK8; Q9BXK9; Q9BXL0;
Q9BXL1; Q9BXL2; Q9BXL3; Q9BXL4;
01-NOV-1995, integrated into UniProtKB/Swiss-Prot.
05-DEC-2001, sequence version 3.
28-MAR-2018, entry version 185.
RecName: Full=ATP-binding cassette sub-family G member 1;
AltName: Full=ATP-binding cassette transporter 8;
AltName: Full=White protein homolog;
Name=ABCG1; Synonyms=ABC8, WHT1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] OF 3-678 (ISOFORMS 1 AND 4).
TISSUE=Retina;
PubMed=8659545;
Chen H.M., Rossier C., Lalioti M.D., Lynn A., Chakravarti A.,
Perrin G., Antonarakis S.E.;
"Cloning of the cDNA for a human homologue of the Drosophila white
gene and mapping to chromosome 21q22.3.";
Am. J. Hum. Genet. 59:66-75(1996).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
PubMed=10950923; DOI=10.1006/geno.2000.6253;
Berry A., Scott H.S., Kudoh J., Talior I., Korostishevsky M.,
Wattenhofer M., Guipponi M., Barras C., Rossier C., Shibuya K.,
Wang J., Kawasaki K., Asakawa S., Minoshima S., Shimizu N.,
Antonarakis S.E., Bonne-Tamir B.;
"Refined localization of autosomal recessive nonsyndromic deafness
DFNB10 locus using 34 novel microsatellite markers, genomic structure,
and exclusion of six known genes in the region.";
Genomics 68:22-29(2000).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), AND REPRESSION BY
ZNF202.
PubMed=11279031; DOI=10.1074/jbc.M100218200;
Porsch-Oezcueruemez M., Langmann T., Heimerl S., Borsukova H.,
Kaminski W.E., Drobnik W., Honer C., Schumacher C., Schmitz G.;
"The zinc finger protein 202 (ZNF202) is a transcriptional repressor
of ATP binding cassette transporter A1 (ABCA1) and ABCG1 gene
expression and a modulator of cellular lipid efflux.";
J. Biol. Chem. 276:12427-12433(2001).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 2; 3; 4; 5; 6 AND
7).
PubMed=11162488; DOI=10.1006/bbrc.2000.4089;
Lorkowski S., Rust S., Engel T., Jung E., Tegelkamp K., Galinski E.A.,
Assmann G., Cullen P.;
"Genomic sequence and structure of the human ABCG1 (ABC8) gene.";
Biochem. Biophys. Res. Commun. 280:121-131(2001).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8), AND VARIANT LEU-668.
PubMed=11500512; DOI=10.1074/jbc.M105863200;
Kennedy M.A., Venkateswaran A., Tarr P.T., Xenarios I., Kudoh J.,
Shimizu N., Edwards P.A.;
"Characterization of the human ABCG1 gene: liver X receptor activates
an internal promoter that produces a novel transcript encoding an
alternative form of the protein.";
J. Biol. Chem. 276:39438-39447(2001).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 1).
PubMed=10830953; DOI=10.1038/35012518;
Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T.,
Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y.,
Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K.,
Polley A., Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D.,
Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W.,
Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S.,
Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E.,
Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P.,
Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H.,
Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E.,
Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F.,
Lehrach H., Reinhardt R., Yaspo M.-L.;
"The DNA sequence of human chromosome 21.";
Nature 405:311-319(2000).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
NUCLEOTIDE SEQUENCE [MRNA] OF 33-678.
TISSUE=Fetal brain;
PubMed=9034316; DOI=10.1016/S0378-1119(96)00633-6;
Croop J.M., Tiller G.E., Fletcher J.A., Lux M.L., Raab E.,
Goldenson D., Son D., Arciniegas S., Wu R.;
"Isolation and characterization of a mammalian homolog of the
Drosophila white gene.";
Gene 185:77-85(1997).
[9]
INDUCTION, AND PROBABLE FUNCTION.
PubMed=10799558; DOI=10.1074/jbc.275.19.14700;
Venkateswaran A., Repa J.J., Lobaccaro J.-M.A., Bronson A.,
Mangelsdorf D.J., Edwards P.A.;
"Human white/murine ABC8 mRNA levels are highly induced in lipid-
loaded macrophages. A transcriptional role for specific oxysterols.";
J. Biol. Chem. 275:14700-14707(2000).
[10]
INDUCTION, AND PROBABLE FUNCTION.
PubMed=10639163; DOI=10.1073/pnas.97.2.817;
Klucken J., Buechler C., Orso E., Kaminski W.E.,
Porsch-Oezcueruemez M., Liebisch G., Kapinsky M., Diederich W.,
Drobnik W., Dean M., Allikmets R., Schmitz G.;
"ABCG1 (ABC8), the human homolog of the Drosophila white gene, is a
regulator of macrophage cholesterol and phospholipid transport.";
Proc. Natl. Acad. Sci. U.S.A. 97:817-822(2000).
[11]
INDUCTION.
PubMed=12032171;
Kaplan R., Gan X., Menke J.G., Wright S.D., Cai T.-Q.;
"Bacterial lipopolysaccharide induces expression of ABCA1 but not
ABCG1 via an LXR-independent pathway.";
J. Lipid Res. 43:952-959(2002).
[12]
REVIEW.
PubMed=11590207;
Schmitz G., Langmann T., Heimerl S.;
"Role of ABCG1 and other ABCG family members in lipid metabolism.";
J. Lipid Res. 42:1513-1520(2001).
[13]
TISSUE SPECIFICITY.
PubMed=11350058; DOI=10.1006/bbrc.2001.4863;
Lorkowski S., Kratz M., Wenner C., Schmidt R., Weitkamp B., Fobker M.,
Reinhardt J., Rauterberg J., Galinski E.A., Cullen P.;
"Expression of the ATP-binding cassette transporter gene ABCG1 (ABC8)
in Tangier disease.";
Biochem. Biophys. Res. Commun. 283:821-830(2001).
[14]
SUBCELLULAR LOCATION, AND MISCELLANEOUS.
PubMed=22042635; DOI=10.1074/mcp.M111.013458;
Uhlen M., Oksvold P., Algenas C., Hamsten C., Fagerberg L.,
Klevebring D., Lundberg E., Odeberg J., Ponten F., Kondo T.,
Sivertsson A.;
"Antibody-based protein profiling of the human chromosome 21.";
Mol. Cell. Proteomics 11:M111.013458-M111.013458(2012).
[15]
PALMITOYLATION AT CYS-30; CYS-154; CYS-315; CYS-394 AND CYS-406, AND
MUTAGENESIS OF CYS-30; CYS-154; CYS-315; CYS-394 AND CYS-406.
PubMed=23388354; DOI=10.1016/j.bbalip.2013.01.019;
Gu H.M., Li G., Gao X., Berthiaume L.G., Zhang D.W.;
"Characterization of palmitoylation of ATP binding cassette
transporter G1: Effect on protein trafficking and function.";
Biochim. Biophys. Acta 1831:1067-1078(2013).
-!- FUNCTION: Transporter involved in macrophage lipid homeostasis. Is
an active component of the macrophage lipid export complex. Could
also be involved in intracellular lipid transport processes. The
role in cellular lipid homeostasis may not be limited to
macrophages.
-!- SUBUNIT: May form heterodimers with several heterologous partners
of the ABCG subfamily.
-!- INTERACTION:
Q9H172:ABCG4; NbExp=2; IntAct=EBI-8584087, EBI-8584118;
-!- SUBCELLULAR LOCATION: Endoplasmic reticulum membrane
{ECO:0000269|PubMed:22042635}; Multi-pass membrane protein
{ECO:0000269|PubMed:22042635}. Golgi apparatus membrane
{ECO:0000269|PubMed:22042635}; Multi-pass membrane protein
{ECO:0000269|PubMed:22042635}. Note=Predominantly localized in the
intracellular compartments mainly associated with the endoplasmic
reticulum (ER) and Golgi membranes.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=8;
Comment=Additional isoforms seem to exist.;
Name=1;
IsoId=P45844-1; Sequence=Displayed;
Name=2; Synonyms=J;
IsoId=P45844-2; Sequence=VSP_000047, VSP_000051;
Name=3; Synonyms=ABDE;
IsoId=P45844-3; Sequence=VSP_000048, VSP_000051;
Name=4; Synonyms=G;
IsoId=P45844-4; Sequence=VSP_000051;
Name=5; Synonyms=F;
IsoId=P45844-5; Sequence=VSP_000049, VSP_000051;
Name=6; Synonyms=HI;
IsoId=P45844-6; Sequence=VSP_000046, VSP_000051;
Name=7; Synonyms=C;
IsoId=P45844-7; Sequence=VSP_000050, VSP_000051;
Name=8;
IsoId=P45844-8; Sequence=VSP_010718;
-!- TISSUE SPECIFICITY: Expressed in several tissues. Expressed in
macrophages; expression is increased in macrophages from patients
with Tangier disease. {ECO:0000269|PubMed:11350058}.
-!- INDUCTION: Strongly induced in monocyte-derived macrophages during
cholesterol influx. Conversely, mRNA and protein expression are
suppressed by lipid efflux. Induction is mediated by the liver X
receptor/retinoid X receptor (LXR/RXR) pathway. Not induced by
bacterial lipopolysaccharides (LPS). Repressed by ZNF202.
{ECO:0000269|PubMed:10639163, ECO:0000269|PubMed:10799558,
ECO:0000269|PubMed:11279031, ECO:0000269|PubMed:12032171}.
-!- PTM: Palmitoylation at Cys-315 seems important for trafficking
from the endoplasmic reticulum. {ECO:0000269|PubMed:23388354}.
-!- MISCELLANEOUS: A protein of the expected size has been detected by
antibody binding and Western blot in at least one of the analyzed
tissues or cells. {ECO:0000305|PubMed:22042635}.
-!- SIMILARITY: Belongs to the ABC transporter superfamily. ABCG
family. Eye pigment precursor importer (TC 3.A.1.204) subfamily.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAC51098.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAK28841.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=BAA95530.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=BAB13728.2; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=CAA62631.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=CAC00730.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=ABCMdb; Note=Database for mutations in ABC
proteins;
URL="http://abcmutations.hegelab.org/proteinDetails?uniprot_id=P45844";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X91249; CAA62631.1; ALT_INIT; mRNA.
EMBL; AB038161; BAB13728.2; ALT_INIT; Genomic_DNA.
EMBL; AJ289137; CAC00730.1; ALT_INIT; Genomic_DNA.
EMBL; AJ289138; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289139; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289140; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289141; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289142; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289143; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289144; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289145; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289146; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289147; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289148; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289149; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289150; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AJ289151; CAC00730.1; JOINED; Genomic_DNA.
EMBL; AF323658; AAK28836.1; -; Genomic_DNA.
EMBL; AF323644; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323645; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323646; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323647; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323648; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323649; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323650; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323651; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323652; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323653; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323654; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323655; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323656; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323657; AAK28836.1; JOINED; Genomic_DNA.
EMBL; AF323664; AAK28842.1; -; mRNA.
EMBL; AF323658; AAK28833.1; -; Genomic_DNA.
EMBL; AF323640; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323645; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323646; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323647; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323648; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323649; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323650; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323651; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323652; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323653; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323654; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323655; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323656; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323657; AAK28833.1; JOINED; Genomic_DNA.
EMBL; AF323660; AAK28838.1; -; mRNA.
EMBL; AF323663; AAK28841.1; ALT_INIT; mRNA.
EMBL; AF323658; AAK28835.1; -; Genomic_DNA.
EMBL; AF323642; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323645; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323646; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323647; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323648; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323649; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323650; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323651; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323652; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323653; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323654; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323655; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323656; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323657; AAK28835.1; JOINED; Genomic_DNA.
EMBL; AF323662; AAK28840.1; -; mRNA.
EMBL; AF323658; AAK28837.1; -; Genomic_DNA.
EMBL; AF323643; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323645; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323646; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323647; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323648; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323649; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323650; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323651; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323652; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323653; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323654; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323655; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323656; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323657; AAK28837.1; JOINED; Genomic_DNA.
EMBL; AF323658; AAK28834.1; -; Genomic_DNA.
EMBL; AF323645; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323646; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323647; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323648; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323649; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323650; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323651; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323652; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323653; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323654; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323655; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323656; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323657; AAK28834.1; JOINED; Genomic_DNA.
EMBL; AF323661; AAK28839.1; -; mRNA.
EMBL; AY048757; AAL06598.1; -; mRNA.
EMBL; AP001746; BAA95530.1; ALT_INIT; Genomic_DNA.
EMBL; BC029158; AAH29158.2; -; mRNA.
EMBL; U34919; AAC51098.1; ALT_INIT; mRNA.
CCDS; CCDS13681.1; -. [P45844-5]
CCDS; CCDS13682.1; -. [P45844-1]
CCDS; CCDS13683.1; -. [P45844-2]
CCDS; CCDS42937.1; -. [P45844-3]
CCDS; CCDS42938.1; -. [P45844-4]
RefSeq; NP_004906.3; NM_004915.3. [P45844-1]
RefSeq; NP_058198.2; NM_016818.2. [P45844-4]
RefSeq; NP_997057.1; NM_207174.1. [P45844-2]
RefSeq; NP_997510.1; NM_207627.1. [P45844-3]
RefSeq; NP_997511.1; NM_207628.1. [P45844-7]
RefSeq; NP_997512.1; NM_207629.1. [P45844-5]
UniGene; Hs.124649; -.
UniGene; Hs.418279; -.
ProteinModelPortal; P45844; -.
BioGrid; 114980; 59.
IntAct; P45844; 5.
STRING; 9606.ENSP00000354995; -.
DrugBank; DB00171; Adenosine triphosphate.
SwissLipids; SLP:000000420; -.
TCDB; 3.A.1.204.12; the atp-binding cassette (abc) superfamily.
iPTMnet; P45844; -.
PhosphoSitePlus; P45844; -.
SwissPalm; P45844; -.
BioMuta; ABCG1; -.
DMDM; 17433715; -.
MaxQB; P45844; -.
PaxDb; P45844; -.
PeptideAtlas; P45844; -.
PRIDE; P45844; -.
TopDownProteomics; P45844-8; -. [P45844-8]
DNASU; 9619; -.
Ensembl; ENST00000343687; ENSP00000339744; ENSG00000160179. [P45844-2]
Ensembl; ENST00000347800; ENSP00000291524; ENSG00000160179. [P45844-5]
Ensembl; ENST00000361802; ENSP00000354995; ENSG00000160179. [P45844-1]
Ensembl; ENST00000398449; ENSP00000381467; ENSG00000160179. [P45844-4]
Ensembl; ENST00000398457; ENSP00000381475; ENSG00000160179. [P45844-3]
GeneID; 9619; -.
KEGG; hsa:9619; -.
UCSC; uc002zan.3; human. [P45844-1]
CTD; 9619; -.
DisGeNET; 9619; -.
EuPathDB; HostDB:ENSG00000160179.18; -.
GeneCards; ABCG1; -.
HGNC; HGNC:73; ABCG1.
HPA; HPA031470; -.
HPA; HPA031471; -.
MIM; 603076; gene.
neXtProt; NX_P45844; -.
OpenTargets; ENSG00000160179; -.
PharmGKB; PA24408; -.
eggNOG; KOG0061; Eukaryota.
eggNOG; COG1131; LUCA.
GeneTree; ENSGT00740000114855; -.
HOVERGEN; HBG103052; -.
InParanoid; P45844; -.
KO; K05679; -.
OMA; QGQCIYR; -.
PhylomeDB; P45844; -.
TreeFam; TF105210; -.
Reactome; R-HSA-1369062; ABC transporters in lipid homeostasis.
Reactome; R-HSA-8964058; HDL remodeling.
SIGNOR; P45844; -.
ChiTaRS; ABCG1; human.
GeneWiki; ABCG1; -.
GenomeRNAi; 9619; -.
PRO; PR:P45844; -.
Proteomes; UP000005640; Chromosome 21.
Bgee; ENSG00000160179; -.
ExpressionAtlas; P45844; baseline and differential.
Genevisible; P45844; HS.
GO; GO:0005789; C:endoplasmic reticulum membrane; IEA:UniProtKB-SubCell.
GO; GO:0005768; C:endosome; ISS:BHF-UCL.
GO; GO:0009897; C:external side of plasma membrane; IDA:BHF-UCL.
GO; GO:0005794; C:Golgi apparatus; HDA:UniProtKB.
GO; GO:0000139; C:Golgi membrane; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; IBA:GO_Central.
GO; GO:0005739; C:mitochondrion; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; HDA:UniProtKB.
GO; GO:0055037; C:recycling endosome; ISS:BHF-UCL.
GO; GO:0043531; F:ADP binding; IDA:BHF-UCL.
GO; GO:0005524; F:ATP binding; IDA:BHF-UCL.
GO; GO:0015485; F:cholesterol binding; IC:BHF-UCL.
GO; GO:0017127; F:cholesterol transporter activity; IDA:BHF-UCL.
GO; GO:0034437; F:glycoprotein transporter activity; IDA:BHF-UCL.
GO; GO:0005543; F:phospholipid binding; IC:BHF-UCL.
GO; GO:0005548; F:phospholipid transporter activity; IDA:BHF-UCL.
GO; GO:0046983; F:protein dimerization activity; NAS:UniProtKB.
GO; GO:0046982; F:protein heterodimerization activity; IPI:BHF-UCL.
GO; GO:0042803; F:protein homodimerization activity; IDA:BHF-UCL.
GO; GO:0034041; F:sterol-transporting ATPase activity; IDA:BHF-UCL.
GO; GO:0019534; F:toxin transmembrane transporter activity; IDA:BHF-UCL.
GO; GO:0042987; P:amyloid precursor protein catabolic process; IDA:BHF-UCL.
GO; GO:0071403; P:cellular response to high density lipoprotein particle stimulus; IEA:Ensembl.
GO; GO:0033344; P:cholesterol efflux; IDA:BHF-UCL.
GO; GO:0042632; P:cholesterol homeostasis; IDA:BHF-UCL.
GO; GO:0008203; P:cholesterol metabolic process; IDA:BHF-UCL.
GO; GO:0009720; P:detection of hormone stimulus; NAS:UniProtKB.
GO; GO:0034436; P:glycoprotein transport; IDA:BHF-UCL.
GO; GO:0034375; P:high-density lipoprotein particle remodeling; ISS:BHF-UCL.
GO; GO:0032367; P:intracellular cholesterol transport; IMP:BHF-UCL.
GO; GO:0034374; P:low-density lipoprotein particle remodeling; ISS:BHF-UCL.
GO; GO:0010887; P:negative regulation of cholesterol storage; TAS:BHF-UCL.
GO; GO:0010745; P:negative regulation of macrophage derived foam cell differentiation; TAS:BHF-UCL.
GO; GO:0033700; P:phospholipid efflux; IMP:BHF-UCL.
GO; GO:0055091; P:phospholipid homeostasis; IMP:BHF-UCL.
GO; GO:0045542; P:positive regulation of cholesterol biosynthetic process; ISS:BHF-UCL.
GO; GO:0010875; P:positive regulation of cholesterol efflux; IEA:Ensembl.
GO; GO:0010872; P:regulation of cholesterol esterification; ISS:BHF-UCL.
GO; GO:0006355; P:regulation of transcription, DNA-templated; ISS:BHF-UCL.
GO; GO:0033993; P:response to lipid; IDA:BHF-UCL.
GO; GO:0010033; P:response to organic substance; IDA:UniProtKB.
GO; GO:0043691; P:reverse cholesterol transport; ISS:BHF-UCL.
GO; GO:0055085; P:transmembrane transport; TAS:Reactome.
InterPro; IPR003593; AAA+_ATPase.
InterPro; IPR013525; ABC_2_trans.
InterPro; IPR003439; ABC_transporter-like.
InterPro; IPR017871; ABC_transporter_CS.
InterPro; IPR020064; ABCG1.
InterPro; IPR027417; P-loop_NTPase.
InterPro; IPR005284; Pigment_permease/Abcg.
PANTHER; PTHR19241:SF177; PTHR19241:SF177; 1.
Pfam; PF01061; ABC2_membrane; 1.
Pfam; PF00005; ABC_tran; 1.
SMART; SM00382; AAA; 1.
SUPFAM; SSF52540; SSF52540; 1.
TIGRFAMs; TIGR00955; 3a01204; 1.
PROSITE; PS00211; ABC_TRANSPORTER_1; 1.
PROSITE; PS50893; ABC_TRANSPORTER_2; 1.
1: Evidence at protein level;
Alternative splicing; ATP-binding; Complete proteome;
Endoplasmic reticulum; Golgi apparatus; Lipid transport; Lipoprotein;
Membrane; Nucleotide-binding; Palmitate; Polymorphism;
Reference proteome; Transmembrane; Transmembrane helix; Transport.
CHAIN 1 678 ATP-binding cassette sub-family G member
1.
/FTId=PRO_0000093384.
TOPO_DOM 1 426 Cytoplasmic. {ECO:0000255}.
TRANSMEM 427 445 Helical. {ECO:0000255}.
TOPO_DOM 446 456 Extracellular. {ECO:0000255}.
TRANSMEM 457 477 Helical. {ECO:0000255}.
TOPO_DOM 478 506 Cytoplasmic. {ECO:0000255}.
TRANSMEM 507 525 Helical. {ECO:0000255}.
TOPO_DOM 526 533 Extracellular. {ECO:0000255}.
TRANSMEM 534 555 Helical. {ECO:0000255}.
TOPO_DOM 556 567 Cytoplasmic. {ECO:0000255}.
TRANSMEM 568 586 Helical. {ECO:0000255}.
TOPO_DOM 587 649 Extracellular. {ECO:0000255}.
TRANSMEM 650 669 Helical. {ECO:0000255}.
TOPO_DOM 670 678 Cytoplasmic. {ECO:0000255}.
DOMAIN 77 317 ABC transporter. {ECO:0000255|PROSITE-
ProRule:PRU00434}.
DOMAIN 415 673 ABC transmembrane type-2.
NP_BIND 118 125 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00434}.
LIPID 30 30 S-palmitoyl cysteine.
{ECO:0000269|PubMed:23388354}.
LIPID 154 154 S-palmitoyl cysteine.
{ECO:0000269|PubMed:23388354}.
LIPID 315 315 S-palmitoyl cysteine.
{ECO:0000269|PubMed:23388354}.
LIPID 394 394 S-palmitoyl cysteine.
{ECO:0000269|PubMed:23388354}.
LIPID 406 406 S-palmitoyl cysteine.
{ECO:0000269|PubMed:23388354}.
VAR_SEQ 1 95 MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNM
EATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDL
SYSVPEGPWWRKK -> MVRRGWSVCTAILLARLWCLVPTH
TFLSEYPEAAEYPHPGWVYWLQMAVAPGHLRAWVMRNNVTT
NIPSAFSGTLTHEEKAVLTVFTGTATAVHVQVAALASAKLE
SSVFVTDCVSCKIENVCDSALQGKRVPMSGLQGSSIVIMPP
SNRPLASAASCTWSVQVQGGPHHLGVVAISGKVLSAAHGAG
RAYGWGFPGDPMEE (in isoform 8).
{ECO:0000303|PubMed:11500512}.
/FTId=VSP_010718.
VAR_SEQ 1 22 Missing (in isoform 7).
{ECO:0000303|PubMed:11162488}.
/FTId=VSP_000050.
VAR_SEQ 1 14 MACLMAAFSVGTAM -> MRISLPRAPERDGGVSASSLLDT
VT (in isoform 2).
{ECO:0000303|PubMed:11162488}.
/FTId=VSP_000047.
VAR_SEQ 1 14 MACLMAAFSVGTAM -> MLGTQGWTKQRKPCPQ (in
isoform 3).
{ECO:0000303|PubMed:11162488}.
/FTId=VSP_000048.
VAR_SEQ 1 14 MACLMAAFSVGTAM -> MIMRLPQPHGT (in isoform
5). {ECO:0000303|PubMed:11162488}.
/FTId=VSP_000049.
VAR_SEQ 1 4 Missing (in isoform 6).
{ECO:0000303|PubMed:11162488}.
/FTId=VSP_000046.
VAR_SEQ 375 386 Missing (in isoform 2, isoform 3, isoform
4, isoform 5, isoform 6 and isoform 7).
{ECO:0000303|PubMed:11162488,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:8659545}.
/FTId=VSP_000051.
VARIANT 668 668 F -> L. {ECO:0000269|PubMed:11500512}.
/FTId=VAR_012279.
MUTAGEN 30 30 C->A: No significant effect.
{ECO:0000269|PubMed:23388354}.
MUTAGEN 154 154 C->A: No significant effect.
{ECO:0000269|PubMed:23388354}.
MUTAGEN 315 315 C->A,S: Significantly decreases ABCG1-
mediated cholesterol efflux.
{ECO:0000269|PubMed:23388354}.
MUTAGEN 394 394 C->A: No significant effect.
{ECO:0000269|PubMed:23388354}.
MUTAGEN 406 406 C->A: No significant effect.
{ECO:0000269|PubMed:23388354}.
CONFLICT 38 38 S -> T (in Ref. 4; AAK28839/AAK28841).
{ECO:0000305}.
CONFLICT 448 448 A -> T (in Ref. 1; CAA62631, 4; AAK28838/
AAK28839/AAK28840/AAK28841/AAK28842 and
5; AAL06598). {ECO:0000305}.
CONFLICT 533 533 R -> A (in Ref. 8; AAC51098).
{ECO:0000305}.
SEQUENCE 678 AA; 75592 MW; B901CABDA6C19E09 CRC64;
MACLMAAFSV GTAMNASSYS AEMTEPKSVC VSVDEVVSSN MEATETDLLN GHLKKVDNNL
TEAQRFSSLP RRAAVNIEFR DLSYSVPEGP WWRKKGYKTL LKGISGKFNS GELVAIMGPS
GAGKSTLMNI LAGYRETGMK GAVLINGLPR DLRCFRKVSC YIMQDDMLLP HLTVQEAMMV
SAHLKLQEKD EGRREMVKEI LTALGLLSCA NTRTGSLSGG QRKRLAIALE LVNNPPVMFF
DEPTSGLDSA SCFQVVSLMK GLAQGGRSII CTIHQPSAKL FELFDQLYVL SQGQCVYRGK
VCNLVPYLRD LGLNCPTYHN PADFVMEVAS GEYGDQNSRL VRAVREGMCD SDHKRDLGGD
AEVNPFLWHR PSEEVKQTKR LKGLRKDSSS MEGCHSFSAS CLTQFCILFK RTFLSIMRDS
VLTHLRITSH IGIGLLIGLL YLGIGNEAKK VLSNSGFLFF SMLFLMFAAL MPTVLTFPLE
MGVFLREHLN YWYSLKAYYL AKTMADVPFQ IMFPVAYCSI VYWMTSQPSD AVRFVLFAAL
GTMTSLVAQS LGLLIGAAST SLQVATFVGP VTAIPVLLFS GFFVSFDTIP TYLQWMSYIS
YVRYGFEGVI LSIYGLDRED LHCDIDETCH FQKSEAILRE LDVENAKLYL DFIVLGIFFI
SLRLIAYFVL RYKIRAER


Related products :

Catalog number Product name Quantity
E1242h ELISA kit ABC1,ABC-1,ABCA1,ATP-binding cassette 1,ATP-binding cassette sub-family A member 1,ATP-binding cassette transporter 1,CERP,Cholesterol efflux regulatory protein,Homo sapiens,Human 96T
E1242h ELISA ABC1,ABC-1,ABCA1,ATP-binding cassette 1,ATP-binding cassette sub-family A member 1,ATP-binding cassette transporter 1,CERP,Cholesterol efflux regulatory protein,Homo sapiens,Human 96T
U1242h CLIA ABC1,ABC-1,ABCA1,ATP-binding cassette 1,ATP-binding cassette sub-family A member 1,ATP-binding cassette transporter 1,CERP,Cholesterol efflux regulatory protein,Homo sapiens,Human 96T
E1242m ELISA kit Abc1,ABC-1,Abca1,ATP-binding cassette 1,ATP-binding cassette sub-family A member 1,ATP-binding cassette transporter 1,Mouse,Mus musculus 96T
U1242m CLIA Abc1,ABC-1,Abca1,ATP-binding cassette 1,ATP-binding cassette sub-family A member 1,ATP-binding cassette transporter 1,Mouse,Mus musculus 96T
E1242m ELISA Abc1,ABC-1,Abca1,ATP-binding cassette 1,ATP-binding cassette sub-family A member 1,ATP-binding cassette transporter 1,Mouse,Mus musculus 96T
E1181h ELISA ABC transporter 9 protein,ABCB9,ATP-binding cassette sub-family B member 9,ATP-binding cassette transporter 9,hABCB9,Homo sapiens,Human,KIAA1520,TAPL,TAP-like protein 96T
U1181h CLIA ABC transporter 9 protein,ABCB9,ATP-binding cassette sub-family B member 9,ATP-binding cassette transporter 9,hABCB9,Homo sapiens,Human,KIAA1520,TAPL,TAP-like protein 96T
E1181h ELISA kit ABC transporter 9 protein,ABCB9,ATP-binding cassette sub-family B member 9,ATP-binding cassette transporter 9,hABCB9,Homo sapiens,Human,KIAA1520,TAPL,TAP-like protein 96T
E1181m ELISA ABC transporter 9 protein,Abcb9,ATP-binding cassette sub-family B member 9,ATP-binding cassette transporter 9,Kiaa1520,mABCB9,Mouse,Mus musculus,TAPL,TAP-like protein 96T
U1181m CLIA ABC transporter 9 protein,Abcb9,ATP-binding cassette sub-family B member 9,ATP-binding cassette transporter 9,Kiaa1520,mABCB9,Mouse,Mus musculus,TAPL,TAP-like protein 96T
E1181m ELISA kit ABC transporter 9 protein,Abcb9,ATP-binding cassette sub-family B member 9,ATP-binding cassette transporter 9,Kiaa1520,mABCB9,Mouse,Mus musculus,TAPL,TAP-like protein 96T
E1181r ELISA ABC transporter 9 protein,Abcb9,ATP-binding cassette sub-family B member 9,ATP-binding cassette transporter 9,Rat,Rattus norvegicus,TAPL,TAP-like protein 96T
E1181r ELISA kit ABC transporter 9 protein,Abcb9,ATP-binding cassette sub-family B member 9,ATP-binding cassette transporter 9,Rat,Rattus norvegicus,TAPL,TAP-like protein 96T
U1181r CLIA ABC transporter 9 protein,Abcb9,ATP-binding cassette sub-family B member 9,ATP-binding cassette transporter 9,Rat,Rattus norvegicus,TAPL,TAP-like protein 96T
20-372-60004 ATP-binding cassette - Mouse monoclonal anti-human ABCF_ antibody; ATP-binding cassette. sub-family F (GCN20). member 1. isoform CRA_a; ABC50 protein Monoclonal 0.1 mg
U1068b CLIA ABCC1,ATP-binding cassette sub-family C member 1,Bos taurus,Bovine,Leukotriene C(4) transporter,LTC4 transporter,MRP1,Multidrug resistance-associated protein 1 96T
E1068r ELISA Abcc1,ATP-binding cassette sub-family C member 1,Leukotriene C(4) transporter,LTC4 transporter,Mrp1,Multidrug resistance-associated protein 1,Rat,Rattus norvegicus 96T
E1068r ELISA kit Abcc1,ATP-binding cassette sub-family C member 1,Leukotriene C(4) transporter,LTC4 transporter,Mrp1,Multidrug resistance-associated protein 1,Rat,Rattus norvegicus 96T
E1068b ELISA ABCC1,ATP-binding cassette sub-family C member 1,Bos taurus,Bovine,Leukotriene C(4) transporter,LTC4 transporter,MRP1,Multidrug resistance-associated protein 1 96T
U1068r CLIA Abcc1,ATP-binding cassette sub-family C member 1,Leukotriene C(4) transporter,LTC4 transporter,Mrp1,Multidrug resistance-associated protein 1,Rat,Rattus norvegicus 96T
E1068b ELISA kit ABCC1,ATP-binding cassette sub-family C member 1,Bos taurus,Bovine,Leukotriene C(4) transporter,LTC4 transporter,MRP1,Multidrug resistance-associated protein 1 96T
E1068h ELISA ABCC1,ATP-binding cassette sub-family C member 1,Homo sapiens,Human,Leukotriene C(4) transporter,LTC4 transporter,MRP,MRP1,Multidrug resistance-associated protein 1 96T
E1068h ELISA kit ABCC1,ATP-binding cassette sub-family C member 1,Homo sapiens,Human,Leukotriene C(4) transporter,LTC4 transporter,MRP,MRP1,Multidrug resistance-associated protein 1 96T
U1068h CLIA ABCC1,ATP-binding cassette sub-family C member 1,Homo sapiens,Human,Leukotriene C(4) transporter,LTC4 transporter,MRP,MRP1,Multidrug resistance-associated protein 1 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur