Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

ATP-dependent DNA helicase DDX11 (EC 3.6.4.12) (CHL1-related protein 1) (hCHLR1) (DEAD/H-box protein 11) (Keratinocyte growth factor-regulated gene 2 protein) (KRG-2)

 DDX11_HUMAN             Reviewed;         970 AA.
Q96FC9; Q13333; Q86VQ4; Q86W62; Q92498; Q92770; Q92998; Q92999;
10-JAN-2006, integrated into UniProtKB/Swiss-Prot.
01-DEC-2001, sequence version 1.
31-JAN-2018, entry version 146.
RecName: Full=ATP-dependent DNA helicase DDX11 {ECO:0000305};
EC=3.6.4.12 {ECO:0000269|PubMed:10648783, ECO:0000269|PubMed:18499658, ECO:0000269|PubMed:22102414, ECO:0000269|PubMed:26089203, ECO:0000269|PubMed:27477908};
AltName: Full=CHL1-related protein 1 {ECO:0000303|PubMed:9013641};
Short=hCHLR1 {ECO:0000303|PubMed:9013641};
AltName: Full=DEAD/H-box protein 11 {ECO:0000312|HGNC:HGNC:2736};
AltName: Full=Keratinocyte growth factor-regulated gene 2 protein {ECO:0000303|PubMed:8798685};
Short=KRG-2 {ECO:0000303|PubMed:8798685};
Name=DDX11 {ECO:0000312|HGNC:HGNC:2736};
Synonyms=CHL1, CHLR1 {ECO:0000303|PubMed:9013641},
KRG2 {ECO:0000303|PubMed:8798685};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY, INDUCTION,
AND VARIANT SER-39.
TISSUE=Keratinocyte;
PubMed=8798685; DOI=10.1074/jbc.271.40.24337;
Frank S., Werner S.;
"The human homologue of the yeast CHL1 gene is a novel keratinocyte
growth factor regulated gene.";
J. Biol. Chem. 271:24337-24340(1996).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, SUBCELLULAR
LOCATION, TISSUE SPECIFICITY, AND VARIANT GLU-567.
PubMed=9013641; DOI=10.1074/jbc.272.6.3823;
Amann J., Kidd V.J., Lahti J.M.;
"Characterization of putative human homologues of the yeast chromosome
transmission fidelity gene, CHL1.";
J. Biol. Chem. 272:3823-3832(1997).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 5), AND VARIANTS GLU-567
AND MET-575.
Ouellette M.M., Wright W.E., Shay J.W.;
"Isolation and characterization of the human homologue of the yeast
CHL1 gene.";
Submitted (OCT-1996) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
TISSUE=Testis, and Uterus;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
CATALYTIC ACTIVITY, ENZYME ACTIVITY, FUNCTION, AND MUTAGENESIS OF
LYS-50.
PubMed=10648783; DOI=10.1093/nar/28.4.917;
Hirota Y., Lahti J.M.;
"Characterization of the enzymatic activity of hChlR1, a novel human
DNA helicase.";
Nucleic Acids Res. 28:917-924(2000).
[6]
FUNCTION, SUBCELLULAR LOCATION, ASSOCIATION WITH A COHESIN COMPLEX,
AND INTERACTION WITH RAD21; SMC1 PROTEINS AND SMC3.
PubMed=17105772; DOI=10.1242/jcs.03262;
Parish J.L., Rosa J., Wang X., Lahti J.M., Doxsey S.J., Androphy E.J.;
"The DNA helicase ChlR1 is required for sister chromatid cohesion in
mammalian cells.";
J. Cell Sci. 119:4857-4865(2006).
[7]
FUNCTION (MICROBIAL INFECTION), INTERACTION WITH BOVINE PAPILLOMAVIRUS
TYPE 1 REGULATORY PROTEIN E2 (MICROBIAL INFECTION), AND SUBCELLULAR
LOCATION (MICROBIAL INFECTION).
PubMed=17189189; DOI=10.1016/j.molcel.2006.11.005;
Parish J.L., Bean A.M., Park R.B., Androphy E.J.;
"ChlR1 is required for loading papillomavirus E2 onto mitotic
chromosomes and viral genome maintenance.";
Mol. Cell 24:867-876(2006).
[8]
FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, ASSOCIATES WITH THE
CTF18-RFC COMPLEX, INTERACTION WITH CHTF18; DSCC1; FEN1; PCNA AND
RFC2, AND MUTAGENESIS OF LYS-50.
PubMed=18499658; DOI=10.1074/jbc.M802696200;
Farina A., Shin J.H., Kim D.H., Bermudez V.P., Kelman Z., Seo Y.S.,
Hurwitz J.;
"Studies with the human cohesin establishment factor, ChlR1.
Association of ChlR1 with Ctf18-RFC and Fen1.";
J. Biol. Chem. 283:20925-20936(2008).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[10]
INVOLVEMENT IN WBRS.
PubMed=20137776; DOI=10.1016/j.ajhg.2010.01.008;
van der Lelij P., Chrzanowska K.H., Godthelp B.C., Rooimans M.A.,
Oostra A.B., Stumm M., Zdzienicka M.Z., Joenje H., de Winter J.P.;
"Warsaw breakage syndrome, a cohesinopathy associated with mutations
in the XPD helicase family member DDX11/ChlR1.";
Am. J. Hum. Genet. 86:262-266(2010).
[11]
FUNCTION, AND INTERACTION WITH TIMELESS.
PubMed=20124417; DOI=10.1242/jcs.057984;
Leman A.R., Noguchi C., Lee C.Y., Noguchi E.;
"Human Timeless and Tipin stabilize replication forks and facilitate
sister-chromatid cohesion.";
J. Cell Sci. 123:660-670(2010).
[12]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[13]
FUNCTION.
PubMed=21854770; DOI=10.1016/j.yexcr.2011.08.006;
Inoue A., Hyle J., Lechner M.S., Lahti J.M.;
"Mammalian ChlR1 has a role in heterochromatin organization.";
Exp. Cell Res. 317:2522-2535(2011).
[14]
FUNCTION, CATALYTIC ACTIVITY, AND MUTAGENESIS OF LYS-50.
PubMed=22102414; DOI=10.1074/jbc.M111.276022;
Wu Y., Sommers J.A., Khan I., de Winter J.P., Brosh R.M. Jr.;
"Biochemical characterization of Warsaw breakage syndrome helicase.";
J. Biol. Chem. 287:1007-1021(2012).
[15]
FUNCTION, INDUCTION, AND TISSUE SPECIFICITY.
PubMed=23116066; DOI=10.1186/1476-4598-11-82;
Bhattacharya C., Wang X., Becker D.;
"The DEAD/DEAH box helicase, DDX11, is essential for the survival of
advanced melanomas.";
Mol. Cancer 11:82-82(2012).
[16]
FUNCTION.
PubMed=23797032; DOI=10.1016/j.yexcr.2013.06.005;
Shah N., Inoue A., Woo Lee S., Beishline K., Lahti J.M., Noguchi E.;
"Roles of ChlR1 DNA helicase in replication recovery from DNA
damage.";
Exp. Cell Res. 319:2244-2253(2013).
[17]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-262, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[18]
FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH POLR1A AND UBTF,
SUBCELLULAR LOCATION, INDUCTION, VARIANT WBRS GLN-263, AND
CHARACTERIZATION OF VARIANT WBRS GLN-263.
PubMed=26089203; DOI=10.1093/hmg/ddv213;
Sun X., Chen H., Deng Z., Hu B., Luo H., Zeng X., Han L., Cai G.,
Ma L.;
"The Warsaw breakage syndrome-related protein DDX11 is required for
ribosomal RNA synthesis and embryonic development.";
Hum. Mol. Genet. 24:4901-4915(2015).
[19]
FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, CHROMATIN-BINDING,
AND RNA-BINDING.
PubMed=27477908; DOI=10.1016/j.molcel.2016.06.031;
Marchese F.P., Grossi E., Marin-Bejar O., Bharti S.K., Raimondi I.,
Gonzalez J., Martinez-Herrera D.J., Athie A., Amadoz A.,
Brosh R.M. Jr., Huarte M.;
"A Long Noncoding RNA Regulates Sister Chromatid Cohesion.";
Mol. Cell 63:397-407(2016).
[20]
FUNCTION, AND INTERACTION WITH TIMELESS.
PubMed=26503245; DOI=10.1093/nar/gkv1112;
Cali F., Bharti S.K., Di Perna R., Brosh R.M. Jr., Pisani F.M.;
"Tim/Timeless, a member of the replication fork protection complex,
operates with the Warsaw breakage syndrome DNA helicase DDX11 in the
same fork recovery pathway.";
Nucleic Acids Res. 44:705-717(2016).
[21]
VARIANT WBRS GLN-263, AND CHARACTERIZATION OF VARIANT WBRS GLN-263.
PubMed=23033317; DOI=10.1002/humu.22226;
Capo-Chichi J.M., Bharti S.K., Sommers J.A., Yammine T., Chouery E.,
Patry L., Rouleau G.A., Samuels M.E., Hamdan F.F., Michaud J.L.,
Brosh R.M. Jr., Megarbane A., Kibar Z.;
"Identification and biochemical characterization of a novel mutation
in DDX11 causing warsaw breakage syndrome.";
Hum. Mutat. 34:103-107(2013).
-!- FUNCTION: DNA-dependent ATPase and ATP-dependent DNA helicase that
participates in various functions in genomic stability, including
DNA replication, DNA repair and heterochromatin organization as
well as in ribosomal RNA synthesis (PubMed:10648783,
PubMed:21854770, PubMed:23797032, PubMed:26089203,
PubMed:26503245). Its double-stranded DNA helicase activity
requires either a minimal 5'-single-stranded tail length of
approximately 15 nt (flap substrates) or 10 nt length single-
stranded gapped DNA substrates of a partial duplex DNA structure
for helicase loading and translocation along DNA in a 5' to 3'
direction (PubMed:18499658, PubMed:22102414). The helicase
activity is capable of displacing duplex regions up to 100 bp,
which can be extended up to 500 bp by the replication protein A
(RPA) or the cohesion CTF18-replication factor C (Ctf18-RFC)
complex activities (PubMed:18499658). Shows also ATPase- and
helicase activities on substrates that mimic key DNA intermediates
of replication, repair and homologous recombination reactions,
including forked duplex, anti-parallel G-quadruplex and three-
stranded D-loop DNA molecules (PubMed:22102414, PubMed:26503245).
Plays a role in DNA double-strand break (DSB) repair at the DNA
replication fork during DNA replication recovery from DNA damage
(PubMed:23797032). Recruited with TIMELESS factor upon DNA-
replication stress response at DNA replication fork to preserve
replication fork progression, and hence ensure DNA replication
fidelity (PubMed:26503245). Cooperates also with TIMELESS factor
during DNA replication to regulate proper sister chromatid
cohesion and mitotic chromosome segregation (PubMed:17105772,
PubMed:18499658, PubMed:20124417, PubMed:23116066,
PubMed:23797032). Stimulates 5'-single-stranded DNA flap
endonuclease activity of FEN1 in an ATP- and helicase-independent
manner; and hence it may contribute in Okazaki fragment processing
at DNA replication fork during lagging strand DNA synthesis
(PubMed:18499658). Its ability to function at DNA replication fork
is modulated by its binding to long non-coding RNA (lncRNA)
cohesion regulator non-coding RNA DDX11-AS1/CONCR, which is able
to increase both DDX11 ATPase activity and binding to DNA
replicating regions (PubMed:27477908). Plays also a role in
heterochromatin organization (PubMed:21854770). Involved in rRNA
transcription activation through binding to active hypomethylated
rDNA gene loci by recruiting UBTF and the RNA polymerase Pol I
transcriptional machinery (PubMed:26089203). Plays a role in
embryonic development and prevention of aneuploidy (By
similarity). Involved in melanoma cell proliferation and survival
(PubMed:23116066). Associates with chromatin at DNA replication
fork regions (PubMed:27477908). Binds to single- and double-
stranded DNAs (PubMed:9013641, PubMed:18499658, PubMed:22102414).
{ECO:0000250|UniProtKB:Q6AXC6, ECO:0000269|PubMed:10648783,
ECO:0000269|PubMed:17105772, ECO:0000269|PubMed:18499658,
ECO:0000269|PubMed:20124417, ECO:0000269|PubMed:21854770,
ECO:0000269|PubMed:22102414, ECO:0000269|PubMed:23116066,
ECO:0000269|PubMed:23797032, ECO:0000269|PubMed:26089203,
ECO:0000269|PubMed:26503245, ECO:0000269|PubMed:27477908}.
-!- FUNCTION: (Microbial infection) Required for bovine papillomavirus
type 1 regulatory protein E2 loading onto mitotic chromosomes
during DNA replication for the viral genome to be maintained and
segregated. {ECO:0000269|PubMed:17189189}.
-!- CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
{ECO:0000269|PubMed:10648783, ECO:0000269|PubMed:18499658,
ECO:0000269|PubMed:22102414, ECO:0000269|PubMed:26089203,
ECO:0000269|PubMed:27477908}.
-!- COFACTOR:
Name=[4Fe-4S] cluster; Xref=ChEBI:CHEBI:49883;
Evidence={ECO:0000250};
Note=Binds 1 [4Fe-4S] cluster. {ECO:0000250};
-!- ENZYME REGULATION: ATPase activity is stimulated by high magnesium
salt levels (up to a 0.1 M), and potassium salts (glutamate,
chloride or acetate) are more effective than the corresponding
sodium salts (PubMed:10648783, PubMed:18499658). ATPase activity
is enhanced by the long non-coding RNA (lncRNA) cohesion regulator
noncoding RNA (CONCR) (PubMed:27477908). Double-stranded DNA
helicase activity is maximal with magnesium ions at low
concentrations (0.5-1 mM) whereas is markedly inhibited at higher
levels (5 mM and above) (PubMed:10648783, PubMed:18499658).
Double-stranded DNA helicase activity is stimulated by 25-50 mM
potassium acetate, stimulated to a lesser extent by 25 mM of
ammonium acetate, and markedly inhibited by sodium acetate
(PubMed:18499658). {ECO:0000269|PubMed:10648783,
ECO:0000269|PubMed:18499658, ECO:0000269|PubMed:27477908}.
-!- SUBUNIT: Associates with the CTF18-RFC complex (PubMed:18499658).
Associates with a cohesin complex composed of RAD21, SMC1 proteins
and SMC3 (PubMed:17105772). Interacts with CHTF18
(PubMed:18499658). Interacts with DSCC1 (PubMed:18499658).
Interacts with FEN1; this interaction is direct and increases flap
endonuclease activity of FEN1 (PubMed:18499658). Interacts with
PCNA (PubMed:18499658). Interacts with POLR1A and UBTF
(PubMed:26089203). Interacts with RAD21, SMC1 proteins and SMC3
(PubMed:17105772). Interacts with RFC2 (PubMed:18499658).
Interacts with TIMELESS; this interaction increases recruitment of
both proteins onto chromatin in response to replication stress
induction by hydroxyurea (PubMed:20124417, PubMed:26503245).
{ECO:0000269|PubMed:17105772, ECO:0000269|PubMed:18499658,
ECO:0000269|PubMed:20124417, ECO:0000269|PubMed:26089203,
ECO:0000269|PubMed:26503245}.
-!- SUBUNIT: (Microbial infection) Interacts with bovine
papillomavirus type 1 regulatory protein E2; this interaction
stimulates the recruitment of E2 onto mitotic chromosomes.
{ECO:0000269|PubMed:17189189}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:17105772}.
Nucleus, nucleolus {ECO:0000269|PubMed:17105772,
ECO:0000269|PubMed:26089203, ECO:0000269|PubMed:9013641}.
Cytoplasm, cytoskeleton, spindle pole
{ECO:0000269|PubMed:17105772}. Midbody
{ECO:0000269|PubMed:17105772}. Cytoplasm, cytoskeleton,
microtubule organizing center, centrosome
{ECO:0000269|PubMed:17105772}. Note=During the early stages of
mitosis, localizes to condensed chromatin and is released from the
chromatin with progression to metaphase. Also localizes to the
spindle poles throughout mitosis and at the midbody at later
stages of mitosis (metaphase to telophase) (PubMed:17105772). In
interphase, colocalizes with nucleolin in the nucleolus
(PubMed:26089203). {ECO:0000269|PubMed:17105772,
ECO:0000269|PubMed:26089203}.
-!- SUBCELLULAR LOCATION: Chromosome {ECO:0000269|PubMed:17189189}.
Note=(Microbial infection) Colocalizes with bovine papillomavirus
type 1 regulatory protein E2 on mitotic chromosomes at early
stages of mitosis. {ECO:0000269|PubMed:17189189}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1;
IsoId=Q96FC9-1; Sequence=Displayed;
Name=2;
IsoId=Q96FC9-2; Sequence=VSP_016864, VSP_016865;
Name=3;
IsoId=Q96FC9-3; Sequence=VSP_016860, VSP_016864, VSP_016865;
Name=4;
IsoId=Q96FC9-4; Sequence=VSP_016863, VSP_016864, VSP_016865;
Name=5;
IsoId=Q96FC9-5; Sequence=VSP_016861, VSP_016862;
-!- TISSUE SPECIFICITY: Expressed in melanoma cells. Not detected in
epidermal melanocytes of normal skin (at protein level)
(PubMed:23116066). Highly expressed in spleen, B-cells, thymus,
testis, ovary, small intestine and pancreas (PubMed:9013641). Very
low expression seen in brain (PubMed:9013641). Expressed in
dividing cells and/or cells undergoing high levels of
recombination (PubMed:9013641). No expression detected in cells
signaled to terminally differentiate (PubMed:9013641). Expressed
weakly in keratinocytes (PubMed:8798685).
{ECO:0000269|PubMed:23116066, ECO:0000269|PubMed:8798685,
ECO:0000269|PubMed:9013641}.
-!- INDUCTION: Up-regulated by serum (at protein level)
(PubMed:26089203). Up-regulated by fibroblast growth factor FGF7
(PubMed:8798685). Expressed in keratinocyte growth factor-
stimulated cells but not in EGF and IL1-beta-treated keratinocytes
(PubMed:8798685). Up-regulated with progression from noninvasive
to invasive melanoma (PubMed:23116066).
{ECO:0000269|PubMed:23116066, ECO:0000269|PubMed:26089203,
ECO:0000269|PubMed:8798685}.
-!- DISEASE: Warsaw breakage syndrome (WBRS) [MIM:613398]: A syndrome
characterized by severe microcephaly, pre- and postnatal growth
retardation, facial dysmorphism and abnormal skin pigmentation.
Additional features include high arched palate, coloboma of the
right optic disk, deafness, ventricular septal defect, toes and
fingers abnormalities. At cellular level, drug-induced chromosomal
breakage, a feature of Fanconi anemia, and sister chromatid
cohesion defects, a feature of Roberts syndrome, coexist.
{ECO:0000269|PubMed:20137776, ECO:0000269|PubMed:23033317,
ECO:0000269|PubMed:26089203}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the DEAD box helicase family. DEAH
subfamily. DDX11/CHL1 sub-subfamily. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=CAA67895.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=CAA67895.1; Type=Frameshift; Positions=644, 648; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11
(DDX11); Note=Leiden Open Variation Database (LOVD);
URL="http://www.lovd.nl/DDX11";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X99583; CAA67895.1; ALT_SEQ; mRNA.
EMBL; U33833; AAB06962.1; -; mRNA.
EMBL; U75967; AAB18749.1; -; mRNA.
EMBL; U75968; AAB18750.1; -; mRNA.
EMBL; BC050069; AAH50069.1; -; mRNA.
EMBL; BC050522; AAH50522.1; -; mRNA.
CCDS; CCDS41767.1; -. [Q96FC9-2]
CCDS; CCDS44856.1; -. [Q96FC9-1]
CCDS; CCDS58224.1; -. [Q96FC9-3]
CCDS; CCDS8721.1; -. [Q96FC9-4]
PIR; G02071; G02071.
RefSeq; NP_001244073.1; NM_001257144.1. [Q96FC9-1]
RefSeq; NP_001244074.1; NM_001257145.1. [Q96FC9-3]
RefSeq; NP_004390.3; NM_004399.2. [Q96FC9-4]
RefSeq; NP_689651.1; NM_152438.1. [Q96FC9-1]
RefSeq; XP_016874421.1; XM_017018932.1. [Q96FC9-2]
UniGene; Hs.443960; -.
ProteinModelPortal; Q96FC9; -.
BioGrid; 108028; 36.
CORUM; Q96FC9; -.
IntAct; Q96FC9; 5.
MINT; MINT-1371028; -.
STRING; 9606.ENSP00000384703; -.
iPTMnet; Q96FC9; -.
PhosphoSitePlus; Q96FC9; -.
BioMuta; DDX11; -.
DMDM; 74731686; -.
MaxQB; Q96FC9; -.
PaxDb; Q96FC9; -.
PeptideAtlas; Q96FC9; -.
PRIDE; Q96FC9; -.
DNASU; 1663; -.
Ensembl; ENST00000228264; ENSP00000228264; ENSG00000013573. [Q96FC9-3]
Ensembl; ENST00000350437; ENSP00000309965; ENSG00000013573. [Q96FC9-4]
Ensembl; ENST00000435753; ENSP00000406799; ENSG00000013573. [Q96FC9-5]
Ensembl; ENST00000542838; ENSP00000443426; ENSG00000013573. [Q96FC9-2]
Ensembl; ENST00000545668; ENSP00000440402; ENSG00000013573. [Q96FC9-1]
GeneID; 1663; -.
KEGG; hsa:1663; -.
UCSC; uc001rjr.2; human. [Q96FC9-1]
CTD; 1663; -.
DisGeNET; 1663; -.
EuPathDB; HostDB:ENSG00000013573.16; -.
GeneCards; DDX11; -.
HGNC; HGNC:2736; DDX11.
HPA; HPA065197; -.
MalaCards; DDX11; -.
MIM; 601150; gene.
MIM; 613398; phenotype.
neXtProt; NX_Q96FC9; -.
OpenTargets; ENSG00000013573; -.
Orphanet; 280558; Warsaw breakage syndrome.
PharmGKB; PA27201; -.
eggNOG; KOG1133; Eukaryota.
eggNOG; COG1199; LUCA.
GeneTree; ENSGT00530000063199; -.
HOVERGEN; HBG058884; -.
InParanoid; Q96FC9; -.
KO; K11273; -.
OMA; FKVQRYC; -.
OrthoDB; EOG091G034C; -.
PhylomeDB; Q96FC9; -.
TreeFam; TF300435; -.
Reactome; R-HSA-381038; XBP1(S) activates chaperone genes.
GeneWiki; DDX11; -.
GenomeRNAi; 1663; -.
PRO; PR:Q96FC9; -.
Proteomes; UP000005640; Chromosome 12.
Bgee; ENSG00000013573; -.
CleanEx; HS_CHL1; -.
CleanEx; HS_DDX11; -.
ExpressionAtlas; Q96FC9; baseline and differential.
Genevisible; Q96FC9; HS.
GO; GO:0005813; C:centrosome; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-KW.
GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB.
GO; GO:0001650; C:fibrillar center; IDA:HPA.
GO; GO:0030496; C:midbody; IDA:UniProtKB.
GO; GO:0000790; C:nuclear chromatin; IDA:UniProtKB.
GO; GO:0005730; C:nucleolus; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; IDA:HPA.
GO; GO:0000922; C:spindle pole; IDA:UniProtKB.
GO; GO:0051539; F:4 iron, 4 sulfur cluster binding; IEA:UniProtKB-KW.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0004003; F:ATP-dependent DNA helicase activity; IDA:UniProtKB.
GO; GO:0008026; F:ATP-dependent helicase activity; IDA:UniProtKB.
GO; GO:0003682; F:chromatin binding; IDA:UniProtKB.
GO; GO:0003677; F:DNA binding; IDA:UniProtKB.
GO; GO:0003688; F:DNA replication origin binding; IMP:UniProtKB.
GO; GO:0008094; F:DNA-dependent ATPase activity; IDA:UniProtKB.
GO; GO:0003690; F:double-stranded DNA binding; IDA:UniProtKB.
GO; GO:0051880; F:G-quadruplex DNA binding; IDA:UniProtKB.
GO; GO:0004386; F:helicase activity; IDA:UniProtKB.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0008186; F:RNA-dependent ATPase activity; IDA:UniProtKB.
GO; GO:0003697; F:single-stranded DNA binding; IDA:UniProtKB.
GO; GO:0003727; F:single-stranded RNA binding; IDA:UniProtKB.
GO; GO:0045142; F:triplex DNA binding; IDA:UniProtKB.
GO; GO:1904976; P:cellular response to bleomycin; IMP:UniProtKB.
GO; GO:0072719; P:cellular response to cisplatin; IMP:UniProtKB.
GO; GO:0006974; P:cellular response to DNA damage stimulus; IMP:UniProtKB.
GO; GO:0072711; P:cellular response to hydroxyurea; IMP:UniProtKB.
GO; GO:0032508; P:DNA duplex unwinding; IDA:UniProtKB.
GO; GO:0006281; P:DNA repair; IEA:UniProtKB-KW.
GO; GO:0044806; P:G-quadruplex DNA unwinding; IDA:UniProtKB.
GO; GO:0036498; P:IRE1-mediated unfolded protein response; TAS:Reactome.
GO; GO:0007275; P:multicellular organism development; IEA:UniProtKB-KW.
GO; GO:0032091; P:negative regulation of protein binding; IMP:UniProtKB.
GO; GO:1990700; P:nucleolar chromatin organization; IMP:UniProtKB.
GO; GO:0035563; P:positive regulation of chromatin binding; IDA:UniProtKB.
GO; GO:2000781; P:positive regulation of double-strand break repair; IMP:UniProtKB.
GO; GO:0032079; P:positive regulation of endodeoxyribonuclease activity; IDA:UniProtKB.
GO; GO:0045876; P:positive regulation of sister chromatid cohesion; IMP:UniProtKB.
GO; GO:1901838; P:positive regulation of transcription of nuclear large rRNA transcript from RNA polymerase I promoter; IMP:UniProtKB.
GO; GO:0031297; P:replication fork processing; IMP:UniProtKB.
GO; GO:0007062; P:sister chromatid cohesion; IDA:UniProtKB.
GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
GO; GO:0016032; P:viral process; IEA:UniProtKB-KW.
InterPro; IPR006555; ATP-dep_Helicase_C.
InterPro; IPR010614; DEAD_2.
InterPro; IPR013020; DNA_helicase_DNA-repair_Rad3.
InterPro; IPR014013; Helic_SF1/SF2_ATP-bd_DinG/Rad3.
InterPro; IPR006554; Helicase-like_DEXD_c2.
InterPro; IPR027417; P-loop_NTPase.
Pfam; PF06733; DEAD_2; 1.
Pfam; PF13307; Helicase_C_2; 1.
SMART; SM00488; DEXDc2; 1.
SMART; SM00491; HELICc2; 1.
SUPFAM; SSF52540; SSF52540; 3.
TIGRFAMs; TIGR00604; rad3; 1.
PROSITE; PS51193; HELICASE_ATP_BIND_2; 1.
1: Evidence at protein level;
4Fe-4S; Activator; Alternative splicing; ATP-binding; Chromosome;
Complete proteome; Cytoplasm; Cytoskeleton; Developmental protein;
Disease mutation; DNA damage; DNA repair; DNA replication;
DNA-binding; Helicase; Host-virus interaction; Hydrolase; Iron;
Iron-sulfur; Metal-binding; Nucleotide-binding; Nucleus;
Phosphoprotein; Polymorphism; Reference proteome; RNA-binding;
Transcription; Transcription regulation.
CHAIN 1 970 ATP-dependent DNA helicase DDX11.
/FTId=PRO_0000055136.
DOMAIN 9 445 Helicase ATP-binding.
{ECO:0000255|PROSITE-ProRule:PRU00541}.
NP_BIND 44 51 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00541}.
MOTIF 393 396 DEAH box.
COMPBIAS 163 224 Glu-rich.
METAL 267 267 Iron-sulfur (4Fe-4S). {ECO:0000250}.
METAL 285 285 Iron-sulfur (4Fe-4S). {ECO:0000250}.
METAL 315 315 Iron-sulfur (4Fe-4S). {ECO:0000250}.
METAL 350 350 Iron-sulfur (4Fe-4S). {ECO:0000250}.
MOD_RES 262 262 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
VAR_SEQ 1 26 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_016860.
VAR_SEQ 214 288 VDEDEDDLEEEHITKIYYCSRTHSQLAQFVHEVKKSPFGKD
VRLVSLGSRQNLCVNEDVKSLGSVQLINDRCVDM -> APS
DATSSRHPPDASFPAALNFLQRTRPSSVLSEDLLMQRAVAK
HPALLPWQMSSSPLRPGSEWMRMRMTWRKNT (in
isoform 5). {ECO:0000303|Ref.3}.
/FTId=VSP_016861.
VAR_SEQ 289 970 Missing (in isoform 5).
{ECO:0000303|Ref.3}.
/FTId=VSP_016862.
VAR_SEQ 685 734 Missing (in isoform 4).
{ECO:0000303|PubMed:8798685}.
/FTId=VSP_016863.
VAR_SEQ 820 906 SPRPGTPREGSGGEPVHEGRQPVHRQGHQAPEGFCQRSAPG
PAICPAPCPGQAAGLDPSPCGGQSYLWPRHCCCAEVSPGEV
GLFLM -> PRAPGQAPPGKALVENLCMKAVNQSIGRAIRH
QKDFASVVLLDQRYARPPVLAKLPAWIRARVEVKATFGPAI
AAVQKFHREKSASS (in isoform 2, isoform 3
and isoform 4).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:8798685,
ECO:0000303|PubMed:9013641,
ECO:0000303|Ref.3}.
/FTId=VSP_016864.
VAR_SEQ 907 970 Missing (in isoform 2, isoform 3 and
isoform 4). {ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:8798685,
ECO:0000303|PubMed:9013641,
ECO:0000303|Ref.3}.
/FTId=VSP_016865.
VARIANT 39 39 I -> S. {ECO:0000269|PubMed:8798685}.
/FTId=VAR_024808.
VARIANT 263 263 R -> Q (in WBRS; impairs the helicase
activity by perturbing its DNA binding
and DNA-dependent ATPase activity;
reduces binding to rDNA promoter and
promotion of rDNA transcription;
dbSNP:rs201968272).
{ECO:0000269|PubMed:23033317,
ECO:0000269|PubMed:26089203}.
/FTId=VAR_069099.
VARIANT 567 567 Q -> E (in dbSNP:rs2075322).
{ECO:0000269|PubMed:9013641,
ECO:0000269|Ref.3}.
/FTId=VAR_024809.
VARIANT 575 575 T -> M (in dbSNP:rs17857386).
{ECO:0000269|Ref.3}.
/FTId=VAR_024810.
VARIANT 856 856 R -> H (in dbSNP:rs1046457).
/FTId=VAR_052175.
VARIANT 864 864 C -> R (in dbSNP:rs3893679).
/FTId=VAR_052176.
VARIANT 951 951 C -> R (in dbSNP:rs1046458).
/FTId=VAR_052177.
VARIANT 966 966 W -> C (in dbSNP:rs14330).
/FTId=VAR_052178.
MUTAGEN 50 50 K->R: Loss of both DNA-dependent ATPase
and ATP-dependent helicase activities.
{ECO:0000269|PubMed:10648783,
ECO:0000269|PubMed:18499658,
ECO:0000269|PubMed:22102414}.
SEQUENCE 970 AA; 108313 MW; 5BF49FE74E912B48 CRC64;
MANETQKVGA IHFPFPFTPY SIQEDFMAEL YRVLEAGKIG IFESPTGTGK SLSLICGALS
WLRDFEQKKR EEEARLLETG TGPLHDEKDE SLCLSSSCEG AAGTPRPAGE PAWVTQFVQK
KEERDLVDRL KAEQARRKQR EERLQQLQHR VQLKYAAKRL RQEEEERENL LRLSREMLET
GPEAERLEQL ESGEEELVLA EYESDEEKKV ASRVDEDEDD LEEEHITKIY YCSRTHSQLA
QFVHEVKKSP FGKDVRLVSL GSRQNLCVNE DVKSLGSVQL INDRCVDMQR SRHEKKKGAE
EEKPKRRRQE KQAACPFYNH EQMGLLRDEA LAEVKDMEQL LALGKEARAC PYYGSRLAIP
AAQLVVLPYQ MLLHAATRQA AGIRLQDQVV IIDEAHNLID TITGMHSVEV SGSQLCQAHS
QLLQYVERYG KRLKAKNLMY LKQILYLLEK FVAVLGGNIK QNPNTQSLSQ TGTELKTIND
FLFQSQIDNI NLFKVQRYCE KSMISRKLFG FTERYGAVFS SREQPKLAGF QQFLQSLQPR
TTEALAAPAD ESQASTLRPA SPLMHIQGFL AALTTANQDG RVILSRQGSL SQSTLKFLLL
NPAVHFAQVV KECRAVVIAG GTMQPVSDFR QQLLACAGVE AERVVEFSCG HVIPPDNILP
LVICSGISNQ PLEFTFQKRE LPQMMDEVGR ILCNLCGVVP GGVVCFFPSY EYLRQVHAHW
EKGGLLGRLA ARKKIFQEPK SAHQVEQVLL AYSRCIQACG QERGQVTGAL LLSVVGGKMS
EGINFSDNLG RCVVMVGMPF PNIRSAELQE KMAYLDQTLS PRPGTPREGS GGEPVHEGRQ
PVHRQGHQAP EGFCQRSAPG PAICPAPCPG QAAGLDPSPC GGQSYLWPRH CCCAEVSPGE
VGLFLMGNHT TAWRRALPLS CPLETVFVVG VVCGDPVTKV KPRRRVWSPE CCQDPGTGVS
SRRRKWGNPE


Related products :

Catalog number Product name Quantity
EIAAB10756 CHL1,CHL1-related protein 1,CHLR1,DDX11,DEAD_H box protein 11,hCHLR1,Homo sapiens,Human,Keratinocyte growth factor-regulated gene 2 protein,KRG2,KRG-2,Probable ATP-dependent RNA helicase DDX11
EIAAB10794 ATP-dependent RNA helicase DDX42,DDX42,DEAD box protein 42,Homo sapiens,Human,RHELP,RNA helicase-like protein,RNA helicase-related protein,RNAHP,SF3b DEAD box protein,SF3b125,Splicing factor 3B-associ
EIAAB10696 ATP-dependent RNA helicase DDX19A,Ddx19,Ddx19a,DEAD box protein 19A,DEAD box RNA helicase DEAD5,Eif4a-rs1,Eukaryotic translation initiation factor 4A-related sequence 1,mDEAD5,Mouse,Mus musculus
EIAAB10762 ATP-dependent RNA helicase DDX18,DDX18,DEAD box protein 18,Homo sapiens,Human,MrDb,Myc-regulated DEAD box protein
EIAAB10824 ATP-dependent 61 kDa nucleolar RNA helicase,DDX21,DDX56,DEAD box protein 21,DEAD box protein 56,Homo sapiens,Human,NOH61,Probable ATP-dependent RNA helicase DDX56
EIAAB10783 ATP-dependent RNA helicase DDX3X,D1Pas1-related sequence 2,D1Pas1-rs2,Ddx3,Ddx3x,DEAD box protein 3, X-chromosomal,DEAD box RNA helicase DEAD3,Dead3,Embryonic RNA helicase,Erh,mDEAD3,Mouse,Mus musculu
EIAAB10759 DDX17,DEAD box protein 17,DEAD box protein p72,Homo sapiens,Human,Probable ATP-dependent RNA helicase DDX17,RNA-dependent helicase p72
EIAAB10815 CAGE,Cancer_testis antigen 26,Cancer-associated gene protein,CT26,DDX53,DEAD box protein 53,DEAD box protein CAGE,Homo sapiens,Human,Probable ATP-dependent RNA helicase DDX53
EIAAB10757 Ddx11,DEAD_H box protein 11,Mouse,Mus musculus,Probable ATP-dependent RNA helicase DDX11
EIAAB10774 ATP-dependent RNA helicase DDX25,Ddx25,DEAD box protein 25,Gonadotropin-regulated testicular RNA helicase,Grth,Mouse,Mus musculus
EIAAB10772 ATP-dependent RNA helicase DDX25,Ddx25,DEAD box protein 25,Gonadotropin-regulated testicular RNA helicase,Grth,Rat,Rattus norvegicus
EIAAB10771 ATP-dependent RNA helicase DDX25,DDX25,DEAD box protein 25,Gonadotropin-regulated testicular RNA helicase,GRTH,Homo sapiens,Human
EIAAB10758 CHL1-related protein 2,CHLR2,DDX12,DDX12P,DEAD_H box protein 12,hCHLR2,Homo sapiens,Human,Putative ATP-dependent RNA helicase DDX12
EIAAB10782 ATP-dependent RNA helicase DDX3X,DBX,DDX3,DDX3X,DEAD box protein 3, X-chromosomal,DEAD box, X isoform,Helicase-like protein 2,HLP2,Homo sapiens,Human
EIAAB10817 ATP-dependent RNA helicase DDX54,ATP-dependent RNA helicase DP97,DDX54,DEAD box protein 54,DEAD box RNA helicase 97 kDa,Homo sapiens,Human
EIAAB10763 Component of gems 3,Ddx20,DEAD box protein 20,DEAD box protein DP 103,Dp103,Gemin3,Gemin-3,Mouse,Mus musculus,Probable ATP-dependent RNA helicase DDX20,Regulator of steroidogenic factor 1,ROSF-1
EIAAB10806 Ddx5,DEAD box protein 5,DEAD box RNA helicase DEAD1,mDEAD1,Mouse,Mus musculus,Probable ATP-dependent RNA helicase DDX5,RNA helicase p68,Tnz2
D11L8_HUMAN ELISA Kit FOR Putative ATP-dependent RNA helicase DDX11-like protein 8; organism: Human; gene name: DDX11L8 96T
EIAAB10785 ATP-dependent RNA helicase DDX3Y,D1Pas1-related sequence 1,D1Pas1-rs1,Ddx3y,DEAD box protein 3, Y-chromosomal,Dead2,DEAD-box RNA helicase DEAD2,mDEAD2,Mouse,Mus musculus
18-003-42774 Spliceosome RNA helicase BAT1 - EC 3.6.1.-; DEAD box protein UAP56; 56 kDa U2AF65-associated protein; ATP-dependent RNA helicase p47; HLA-B-associated transcript-1 Polyclonal 0.05 mg Aff Pur
EIAAB10825 DDX58,DEAD box protein 58,Pig,Probable ATP-dependent RNA helicase DDX58,Retinoic acid-inducible gene 1 protein,Retinoic acid-inducible gene I protein,RHIV-1,RIG-1,RIG-I,RNA helicase induced by virus,S
EIAAB10334 DDX11L8,DEAD_H box protein 11-like 8,Homo sapiens,Human,Putative ATP-dependent RNA helicase DDX11-like protein 8
18-003-42773 Probable ATP-dependent RNA helicase DDX6 - EC 3.6.1.-; DEAD box protein 6; ATP-dependent RNA helicase p54; Oncogene RCK Polyclonal 0.1 mg Protein A
EIAAB10697 ATP-dependent RNA helicase DDX19B,DBP5,DDX19,DDX19B,DEAD box protein 19B,DEAD box RNA helicase DEAD5,Homo sapiens,Human,TDBP
EIAAB12133 ATP-dependent RNA helicase DDX39A,Ddx39,Ddx39a,Ddxl,DEAD box protein 39,Nuclear RNA helicase, DECD variant of DEAD box family,Rat,Rattus norvegicus


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur