Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Adhesion G-protein coupled receptor D1 (G-protein coupled receptor 133) (G-protein coupled receptor PGR25)

 AGRD1_HUMAN             Reviewed;         874 AA.
Q6QNK2; B2CKK9; B7ZLF7; Q2M1L3; Q6ZMQ1; Q7Z7M2; Q86SM4;
15-FEB-2005, integrated into UniProtKB/Swiss-Prot.
05-JUL-2004, sequence version 1.
10-MAY-2017, entry version 122.
RecName: Full=Adhesion G-protein coupled receptor D1 {ECO:0000303|PubMed:25713288};
AltName: Full=G-protein coupled receptor 133;
AltName: Full=G-protein coupled receptor PGR25;
Flags: Precursor;
Name=ADGRD1; Synonyms=GPR133, PGR25;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Brain;
Bonner T.I., Nagle J.W., Kauffman D.;
Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
PubMed=15203201; DOI=10.1016/j.ygeno.2003.12.004;
Bjarnadottir T.K., Fredriksson R., Hoeglund P.J., Gloriam D.E.,
Lagerstroem M.C., Schioeth H.B.;
"The human and mouse repertoire of the adhesion family of G-protein-
coupled receptors.";
Genomics 84:23-33(2004).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND ALTERNATIVE SPLICING.
Bonner T.I., Sloger M., Nagle J.W., Kauffman D.;
"Common splice variant of human GPR133 in brain.";
Submitted (FEB-2008) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Brain;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16541075; DOI=10.1038/nature04569;
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y.,
Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C.,
Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M.,
Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L.,
Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B.,
Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D.,
Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z.,
Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z.,
Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H.,
Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H.,
Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V.,
Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J.,
Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A.,
Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M.,
Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E.,
Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K.,
Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D.,
Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M.,
Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R.,
Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J.,
Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C.,
Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M.,
Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M.,
Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P.,
Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L.,
Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E.,
Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C.,
Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F.,
Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M.,
Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S.,
Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J.,
Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A.,
Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M.,
Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I.,
Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A.,
Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D.,
Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I.,
Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T.,
Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S.,
Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D.,
Kucherlapati R., Weinstock G., Gibbs R.A.;
"The finished DNA sequence of human chromosome 12.";
Nature 440:346-351(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 355-708.
PubMed=12679517; DOI=10.1073/pnas.0230374100;
Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
Bergmann J.E., Gaitanaris G.A.;
"The G protein-coupled receptor repertoires of human and mouse.";
Proc. Natl. Acad. Sci. U.S.A. 100:4903-4908(2003).
[8]
FUNCTION, MUTAGENESIS OF HIS-543 AND LEU-808, SUBCELLULAR LOCATION,
AND DOMAIN.
PubMed=22025619; DOI=10.1074/jbc.C111.265934;
Bohnekamp J., Schoneberg T.;
"Cell adhesion receptor GPR133 couples to Gs protein.";
J. Biol. Chem. 286:41912-41916(2011).
[9]
FUNCTION.
PubMed=22575658; DOI=10.1016/j.febslet.2012.03.014;
Gupte J., Swaminath G., Danao J., Tian H., Li Y., Wu X.;
"Signaling property study of adhesion G-protein-coupled receptors.";
FEBS Lett. 586:1214-1219(2012).
[10]
STACHEL MOTIF, MUTAGENESIS OF THR-545; LEU-550; MET-551 AND VAL-554,
AND SUBCELLULAR LOCATION.
PubMed=25533341; DOI=10.1016/j.celrep.2014.11.036;
Liebscher I., Schoen J., Petersen S.C., Fischer L., Auerbach N.,
Demberg L.M., Mogha A., Coester M., Simon K.U., Rothemund S.,
Monk K.R., Schoeneberg T.;
"A tethered agonist within the ectodomain activates the adhesion G
protein-coupled receptors GPR126 and GPR133.";
Cell Rep. 9:2018-2026(2014).
[11]
NOMENCLATURE.
PubMed=25713288; DOI=10.1124/pr.114.009647;
Hamann J., Aust G., Arac D., Engel F.B., Formstone C., Fredriksson R.,
Hall R.A., Harty B.L., Kirchhoff C., Knapp B., Krishnan A.,
Liebscher I., Lin H.H., Martinelli D.C., Monk K.R., Peeters M.C.,
Piao X., Promel S., Schoneberg T., Schwartz T.W., Singer K.,
Stacey M., Ushkaryov Y.A., Vallon M., Wolfrum U., Wright M.W., Xu L.,
Langenhan T., Schioth H.B.;
"International union of basic and clinical pharmacology. XCIV.
Adhesion G protein-coupled receptors.";
Pharmacol. Rev. 67:338-367(2015).
[12]
CHARACTERIZATION OF VARIANTS CYS-18; HIS-18; ASN-32; LYS-78; MET-82;
CYS-85; ASP-89; MET-110; PHE-138; SER-140; ASP-141; LEU-145; TRP-150;
SER-174; LYS-178; ILE-184; ARG-195; CYS-199; HIS-199; ASP-203;
MET-209; ASN-226; TRP-233; THR-241; THR-242; ILE-245; ALA-257;
GLN-259; TYR-265; ASN-268; ALA-270; MET-270; ALA-293; ARG-294;
SER-308; PHE-318; ASN-349; SER-364; MET-369; SER-383; MET-393;
GLN-397; CYS-399; PRO-405; PRO-410; SER-411; LYS-413; VAL-419;
SER-425; THR-441; ASP-448; ASN-453; TYR-454; THR-458; ALA-464;
SER-476; LEU-478; MET-484; ILE-485; GLY-498; SER-499; MET-508;
LEU-523; SER-524; ALA-538; ILE-538; CYS-540; HIS-540; CYS-560;
HIS-560; LEU-567; VAL-569; THR-589; MET-594; HIS-601; HIS-608;
CYS-624; LYS-626; LEU-667; HIS-673; THR-695; VAL-699; VAL-720;
THR-743; ARG-749; GLU-751; GLU-761; MET-777; VAL-779; MET-793;
LYS-795; THR-816; MET-827; THR-831; THR-836; VAL-836; THR-851;
HIS-868; ILE-869; ASN-870 AND MET-874.
PubMed=27516204; DOI=10.1186/s12864-016-2937-2;
Fischer L., Wilde C., Schoeneberg T., Liebscher I.;
"Functional relevance of naturally occurring mutations in adhesion G
protein-coupled receptor ADGRD1 (GPR133).";
BMC Genomics 17:609-609(2016).
[13]
INDUCTION, AND TISSUE SPECIFICITY.
PubMed=27775701; DOI=10.1038/oncsis.2016.63;
Bayin N.S., Frenster J.D., Kane J.R., Rubenstein J., Modrek A.S.,
Baitalmal R., Dolgalev I., Rudzenski K., Scarabottolo L., Crespi D.,
Redaelli L., Snuderl M., Golfinos J.G., Doyle W., Pacione D.,
Parker E.C., Chi A.S., Heguy A., MacNeil D.J., Shohdy N., Zagzag D.,
Placantonakis D.G.;
"GPR133 (ADGRD1), an adhesion G-protein-coupled receptor, is necessary
for glioblastoma growth.";
Oncogenesis 5:E263-E263(2016).
-!- FUNCTION: Orphan receptor. Signals via G(s)-alpha family of G-
proteins (PubMed:22025619, PubMed:22575658). Has protumorigenic
function especially in glioblastoma (PubMed:27775701).
{ECO:0000269|PubMed:22025619, ECO:0000269|PubMed:22575658,
ECO:0000269|PubMed:27775701}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:22025619,
ECO:0000269|PubMed:25533341}; Multi-pass membrane protein
{ECO:0000255}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q6QNK2-1; Sequence=Displayed;
Name=2;
IsoId=Q6QNK2-2; Sequence=VSP_012788, VSP_012789;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q6QNK2-3; Sequence=VSP_012787, VSP_012790;
Note=No experimental confirmation available.;
Name=4;
IsoId=Q6QNK2-4; Sequence=VSP_053678;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Up-regulated in CD133(+) cell population of
glioblastoma. {ECO:0000269|PubMed:27775701}.
-!- INDUCTION: Up-regulated by hypoxia in hypoxia-inducible factor 1-
alpha (HIF1A)-dependent manner. {ECO:0000269|PubMed:27775701}.
-!- DOMAIN: A short peptide sequence (termed the Stachel sequence) in
the C-terminal part of the extracellular domain (ECD) functions as
a tethered agonist. Upon structural changes within the ECD, e.g.
due to extracellular ligand binding or mechanical movements, this
intramolecular agonist is exposed to the 7 transmembrane region,
triggering G-protein activation. {ECO:0000269|PubMed:25533341}.
-!- DOMAIN: The N-terminal domain and autocatalytic activity of ADGRD1
at the GPCR proteolysis site (GPS) are not required for G-protein
coupling activity. {ECO:0000269|PubMed:22025619}.
-!- SIMILARITY: Belongs to the G-protein coupled receptor 2 family.
Adhesion G-protein coupled receptor (ADGR) subfamily.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY532280; AAS37682.1; -; mRNA.
EMBL; AY278561; AAP35063.1; -; mRNA.
EMBL; EU523118; ACB20802.1; -; mRNA.
EMBL; AK131538; BAD18674.1; -; mRNA.
EMBL; AC073862; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC078925; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC126564; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC112307; AAI12308.1; -; mRNA.
EMBL; BC112309; AAI12310.1; -; mRNA.
EMBL; BC143775; AAI43776.1; -; mRNA.
EMBL; AY255587; AAO85099.1; -; mRNA.
CCDS; CCDS81753.1; -. [Q6QNK2-4]
CCDS; CCDS9272.1; -. [Q6QNK2-1]
PIR; T47186; T47186.
RefSeq; NP_001317426.1; NM_001330497.1. [Q6QNK2-4]
RefSeq; NP_942122.2; NM_198827.4. [Q6QNK2-1]
UniGene; Hs.719239; -.
ProteinModelPortal; Q6QNK2; -.
STRING; 9606.ENSP00000261654; -.
MEROPS; P02.021; -.
iPTMnet; Q6QNK2; -.
PhosphoSitePlus; Q6QNK2; -.
BioMuta; GPR133; -.
DMDM; 59797935; -.
PaxDb; Q6QNK2; -.
PeptideAtlas; Q6QNK2; -.
PRIDE; Q6QNK2; -.
DNASU; 283383; -.
Ensembl; ENST00000261654; ENSP00000261654; ENSG00000111452. [Q6QNK2-1]
Ensembl; ENST00000535015; ENSP00000444425; ENSG00000111452. [Q6QNK2-4]
Ensembl; ENST00000543617; ENSP00000438021; ENSG00000111452. [Q6QNK2-3]
GeneID; 283383; -.
KEGG; hsa:283383; -.
UCSC; uc001uit.5; human. [Q6QNK2-1]
CTD; 283383; -.
DisGeNET; 283383; -.
GeneCards; ADGRD1; -.
HGNC; HGNC:19893; ADGRD1.
HPA; HPA042395; -.
MIM; 613639; gene.
neXtProt; NX_Q6QNK2; -.
OpenTargets; ENSG00000111452; -.
PharmGKB; PA134923933; -.
eggNOG; KOG4193; Eukaryota.
eggNOG; ENOG410XSD2; LUCA.
GeneTree; ENSGT00830000128227; -.
HOGENOM; HOG000056451; -.
HOVERGEN; HBG051779; -.
InParanoid; Q6QNK2; -.
KO; K08465; -.
OrthoDB; EOG091G00GJ; -.
PhylomeDB; Q6QNK2; -.
TreeFam; TF351999; -.
ChiTaRS; GPR133; human.
GenomeRNAi; 283383; -.
PRO; PR:Q6QNK2; -.
Proteomes; UP000005640; Chromosome 12.
Bgee; ENSG00000111452; -.
CleanEx; HS_GPR133; -.
ExpressionAtlas; Q6QNK2; baseline and differential.
Genevisible; Q6QNK2; HS.
GO; GO:0016021; C:integral component of membrane; TAS:GDB.
GO; GO:0005886; C:plasma membrane; IDA:UniProtKB.
GO; GO:0004930; F:G-protein coupled receptor activity; IDA:UniProtKB.
GO; GO:0007166; P:cell surface receptor signaling pathway; IEA:InterPro.
GO; GO:0007186; P:G-protein coupled receptor signaling pathway; IDA:UniProtKB.
GO; GO:0010579; P:positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway; IDA:UniProtKB.
InterPro; IPR013320; ConA-like_dom.
InterPro; IPR017981; GPCR_2-like.
InterPro; IPR000832; GPCR_2_secretin-like.
InterPro; IPR017983; GPCR_2_secretin-like_CS.
InterPro; IPR000203; GPS.
Pfam; PF00002; 7tm_2; 1.
Pfam; PF01825; GPS; 1.
PRINTS; PR00249; GPCRSECRETIN.
SMART; SM00303; GPS; 1.
SUPFAM; SSF49899; SSF49899; 1.
PROSITE; PS00650; G_PROTEIN_RECEP_F2_2; 1.
PROSITE; PS50261; G_PROTEIN_RECEP_F2_4; 1.
PROSITE; PS50221; GPS; 1.
PROSITE; PS51828; PTX_2; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome;
G-protein coupled receptor; Glycoprotein; Membrane; Polymorphism;
Receptor; Reference proteome; Signal; Transducer; Transmembrane;
Transmembrane helix.
SIGNAL 1 25 {ECO:0000255}.
CHAIN 26 874 Adhesion G-protein coupled receptor D1.
/FTId=PRO_0000012905.
TOPO_DOM 26 570 Extracellular. {ECO:0000305}.
TRANSMEM 571 591 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 592 602 Cytoplasmic. {ECO:0000305}.
TRANSMEM 603 623 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 624 633 Extracellular. {ECO:0000305}.
TRANSMEM 634 654 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 655 674 Cytoplasmic. {ECO:0000305}.
TRANSMEM 675 695 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 696 711 Extracellular. {ECO:0000305}.
TRANSMEM 712 732 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 733 760 Cytoplasmic. {ECO:0000305}.
TRANSMEM 761 781 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 782 784 Extracellular. {ECO:0000305}.
TRANSMEM 785 805 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 806 874 Cytoplasmic. {ECO:0000305}.
DOMAIN 79 276 Pentraxin (PTX). {ECO:0000255|PROSITE-
ProRule:PRU01172}.
DOMAIN 507 556 GPS. {ECO:0000255|PROSITE-
ProRule:PRU00098}.
MOTIF 546 554 Stachel. {ECO:0000305|PubMed:25533341}.
CARBOHYD 90 90 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 185 185 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 282 282 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 302 302 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 319 319 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 394 394 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 476 476 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 501 501 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 533 533 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 481 Missing (in isoform 3).
{ECO:0000303|PubMed:15203201}.
/FTId=VSP_012787.
VAR_SEQ 1 314 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_012788.
VAR_SEQ 62 62 G -> GASRTHKLTVLPSRNATFVYSNDSAYSNLSATV
(in isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_053678.
VAR_SEQ 315 341 QTALNLTKTFLKAVGEILLLPGWIALS -> MEKGTELLVS
PSQSGPGGDQPLLVKHR (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_012789.
VAR_SEQ 482 491 LITVHLKHRL -> MHRVCFLSFQ (in isoform 3).
{ECO:0000303|PubMed:15203201}.
/FTId=VSP_012790.
VARIANT 18 18 Y -> C (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs149181066).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077698.
VARIANT 18 18 Y -> H (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs146611221).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077699.
VARIANT 32 32 D -> N (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs376178471).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077700.
VARIANT 78 78 E -> K (polymorphism; does not affect
subcellular location; increases G-protein
coupled receptor activity;
dbSNP:rs267603378).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077701.
VARIANT 82 82 T -> M (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs143395855).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077702.
VARIANT 85 85 Y -> C (polymorphism; does not affect
subcellular location; decreases G-protein
coupled receptor activity;
dbSNP:rs199848650).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077703.
VARIANT 89 89 Y -> D (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs201546462).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077704.
VARIANT 110 110 F -> L (polymorphism; reduces cell
membrane location; decreases G-protein
coupled receptor activity;
dbSNP:rs148928637).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077705.
VARIANT 138 138 S -> F (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs199526762).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077706.
VARIANT 140 140 G -> S (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs374985420).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077707.
VARIANT 141 141 G -> D (polymorphism; does not affect
subcellular location; increases G-protein
coupled receptor activity;
dbSNP:rs142759046).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077708.
VARIANT 145 145 V -> L (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs146945782).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077709.
VARIANT 150 150 R -> W (polymorphism; does not affect
subcellular location; decreases G-protein
coupled receptor activity;
dbSNP:rs144030317).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077710.
VARIANT 174 174 W -> S (polymorphism; reduces cell
membrane location; decreases G-protein
coupled receptor activity;
dbSNP:rs141606054).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077711.
VARIANT 178 178 E -> K (polymorphism; reduces cell
membrane location; decreases G-protein
coupled receptor activity;
dbSNP:rs148148477).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077712.
VARIANT 184 184 V -> I (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs61732860).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077713.
VARIANT 195 195 G -> R (polymorphism; reduces cell
membrane location; decreases G-protein
coupled receptor activity;
dbSNP:rs267603379).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077714.
VARIANT 199 199 R -> C (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs146310036).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077715.
VARIANT 199 199 R -> H (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs375084180).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077716.
VARIANT 203 203 E -> D (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs201045213).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077717.
VARIANT 209 209 V -> M (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs139478688).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077718.
VARIANT 226 226 D -> N (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs377562590).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077719.
VARIANT 233 233 R -> W (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs370807516).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077720.
VARIANT 241 241 A -> T (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs368468703).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077721.
VARIANT 242 242 M -> T (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs201057341).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077722.
VARIANT 245 245 T -> I (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs201053759).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077723.
VARIANT 257 257 T -> A (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs146563785).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077724.
VARIANT 259 259 P -> Q (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs75096240).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077725.
VARIANT 265 265 S -> Y (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs137909892).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077726.
VARIANT 268 268 S -> N (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs149012578).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077727.
VARIANT 270 270 V -> A (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs147773154).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077728.
VARIANT 270 270 V -> M (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs147773154).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077729.
VARIANT 293 293 P -> A (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs146929634).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077730.
VARIANT 294 294 G -> R (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs148017957).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077731.
VARIANT 308 308 P -> S (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs201661954).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077732.
VARIANT 318 318 L -> F (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs200641036).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077733.
VARIANT 349 349 S -> N (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs370854685).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077734.
VARIANT 364 364 N -> S (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs146050435).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077735.
VARIANT 369 369 T -> M (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs142314859).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077736.
VARIANT 383 383 F -> S (polymorphism; does not affect
subcellular location; increases G-protein
coupled receptor activity;
dbSNP:rs200232576).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077737.
VARIANT 393 393 V -> M (polymorphism; does not affect
subcellular location; increases G-protein
coupled receptor activity;
dbSNP:rs374606811).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077738.
VARIANT 397 397 H -> Q (polymorphism; does not affect
subcellular location; dbSNP:rs201985264).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077739.
VARIANT 399 399 R -> C (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs150882180).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077740.
VARIANT 404 404 G -> A (polymorphism; does not affect
subcellular location; increases G-protein
coupled receptor activity;
dbSNP:rs371536090).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077741.
VARIANT 405 405 Q -> P (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs145663007).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077742.
VARIANT 410 410 I -> V (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs376489706).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077743.
VARIANT 411 411 P -> S (polymorphism; does not affect
subcellular location; increases G-protein
coupled receptor activity;
dbSNP:rs147757048).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077744.
VARIANT 413 413 E -> K (polymorphism; does not affect
subcellular location; increases G-protein
coupled receptor activity;
dbSNP:rs142628291).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077745.
VARIANT 419 419 A -> V (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs370959644).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077746.
VARIANT 425 425 G -> S (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs374575404).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077747.
VARIANT 441 441 A -> T (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs375271891).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077748.
VARIANT 448 448 A -> D (polymorphism; reduces cell
membrane location; decreases G-protein
coupled receptor activity;
dbSNP:rs200173874).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077749.
VARIANT 450 450 H -> R (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs200060202).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077750.
VARIANT 453 453 D -> N (polymorphism; does not affect
subcellular location; increases G-protein
coupled receptor activity;
dbSNP:rs149065791).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077751.
VARIANT 454 454 C -> Y (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs143062748).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077752.
VARIANT 458 458 A -> T (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs140426880).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077753.
VARIANT 464 464 S -> A (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs78638447).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077754.
VARIANT 476 476 N -> S (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs138163855).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077755.
VARIANT 478 478 S -> L (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs372643228).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077756.
VARIANT 484 484 T -> M (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs149266247).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077757.
VARIANT 485 485 V -> I (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs369012277).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077758.
VARIANT 498 498 E -> G (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs200576124).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077759.
VARIANT 499 499 A -> S (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs150620459).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077760.
VARIANT 508 508 V -> M (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs11833801).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_049461.
VARIANT 523 523 S -> L (polymorphism; does not change G-
protein coupled receptor activity;
dbSNP:rs11061318).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_049462.
VARIANT 524 524 N -> K (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs370443698).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077761.
VARIANT 538 538 V -> A (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs201849687).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077762.
VARIANT 538 538 V -> I (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs200971352).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077763.
VARIANT 540 540 R -> C (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs147294464).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077764.
VARIANT 540 540 R -> H (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs145630930).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077765.
VARIANT 560 560 R -> C (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs371989819).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077766.
VARIANT 560 560 R -> H (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs375179921).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077767.
VARIANT 567 567 S -> L (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs192515185).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077768.
VARIANT 569 569 I -> V (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs139017446).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077769.
VARIANT 589 589 A -> T (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs201161291).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077770.
VARIANT 594 594 V -> M (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs189007948).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077771.
VARIANT 601 601 R -> H (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs201524753).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077772.
VARIANT 608 608 L -> M (polymorphism; does not affect
subcellular location; decreases G-protein
coupled receptor activity;
dbSNP:rs200052797).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077773.
VARIANT 624 624 R -> C (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs117457351).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077774.
VARIANT 626 626 E -> K (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs199778477).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077775.
VARIANT 630 630 T -> I (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs145482553).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077776.
VARIANT 667 667 S -> L (polymorphism; does not affect
subcellular location; decreases G-protein
coupled receptor activity;
dbSNP:rs377401276).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077777.
VARIANT 673 673 R -> H (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs141128784).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077778.
VARIANT 695 695 M -> T (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs143163307).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077779.
VARIANT 699 699 G -> V (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077780.
VARIANT 720 720 A -> V (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs141439159).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077781.
VARIANT 743 743 A -> T (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs143902981).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077782.
VARIANT 749 749 H -> R (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs372207677).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077783.
VARIANT 751 751 D -> E (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs147763331).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077784.
VARIANT 761 761 A -> E (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs369201469).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077785.
VARIANT 764 764 V -> M (polymorphism; reduces cell
membrane location; decreases G-protein
coupled receptor activity;
dbSNP:rs149434203).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077786.
VARIANT 777 777 V -> M (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs144814859).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077787.
VARIANT 779 779 A -> V (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs61746588).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077788.
VARIANT 793 793 T -> M (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs375488636).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077789.
VARIANT 795 795 N -> K (polymorphism; decreases cell
surface location; abolishes G-protein
coupled receptor activity;
dbSNP:rs369853823).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077790.
VARIANT 816 816 A -> T (polymorphism; reduces cell
membrane location; decreases G-protein
coupled receptor activity;
dbSNP:rs368828722).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077791.
VARIANT 827 827 T -> M (polymorphism; does not affect
subcellular location; increases G-protein
coupled receptor activity;
dbSNP:rs371135988).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077792.
VARIANT 831 831 A -> T (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs146661482).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077793.
VARIANT 836 836 A -> T (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs144023497).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077794.
VARIANT 836 836 A -> V (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs367789023).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077795.
VARIANT 851 851 M -> T (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs78058857).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077796.
VARIANT 868 868 R -> H (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs61740366).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077797.
VARIANT 869 869 V -> I (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs377434309).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077798.
VARIANT 870 870 D -> N (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs143670024).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077799.
VARIANT 874 874 V -> M (polymorphism; does not affect
subcellular location; does not change G-
protein coupled receptor activity;
dbSNP:rs148442158).
{ECO:0000269|PubMed:27516204}.
/FTId=VAR_077800.
MUTAGEN 543 543 H->R: Does not affect membrane
trafficking and basal activity.
{ECO:0000269|PubMed:22025619}.
MUTAGEN 545 545 T->A: No effect on G-protein coupled
receptor activity; does not affect
subcellular location.
{ECO:0000269|PubMed:25533341}.
MUTAGEN 550 550 L->A: Abolishes G-protein coupled
receptor activity; does not affect
subcellular location.
{ECO:0000269|PubMed:25533341}.
MUTAGEN 551 551 M->A: Abolishes G-protein coupled
receptor activity; does not affect
subcellular location.
{ECO:0000269|PubMed:25533341}.
MUTAGEN 554 554 V->A: Abolishes G-protein coupled
receptor activity; does not affect
subcellular location.
{ECO:0000269|PubMed:25533341}.
MUTAGEN 808 808 L->T: Does not affect membrane
trafficking. Abolishes receptor activity.
{ECO:0000269|PubMed:22025619}.
CONFLICT 703 703 N -> S (in Ref. 2; AAP35063).
{ECO:0000305}.
SEQUENCE 874 AA; 96530 MW; 8FC7C63D50F65E1B CRC64;
MEKLLRLCCW YSWLLLFYYN FQVRGVYSRS QDHPGFQVLA SASHYWPLEN VDGIHELQDT
TGDIVEGKVN KGIYLKEEKG VTLLYYGRYN SSCISKPEQC GPEGVTFSFF WKTQGEQSRP
IPSAYGGQVI SNGFKVCSSG GRGSVELYTR DNSMTWEASF SPPGPYWTHV LFTWKSKEGL
KVYVNGTLST SDPSGKVSRD YGESNVNLVI GSEQDQAKCY ENGAFDEFII WERALTPDEI
AMYFTAAIGK HALLSSTLPS LFMTSTASPV MPTDAYHPII TNLTEERKTF QSPGVILSYL
QNVSLSLPSK SLSEQTALNL TKTFLKAVGE ILLLPGWIAL SEDSAVVLSL IDTIDTVMGH
VSSNLHGSTP QVTVEGSSAM AEFSVAKILP KTVNSSHYRF PAHGQSFIQI PHEAFHRHAW
STVVGLLYHS MHYYLNNIWP AHTKIAEAMH HQDCLLFATS HLISLEVSPP PTLSQNLSGS
PLITVHLKHR LTRKQHSEAT NSSNRVFVYC AFLDFSSGEG VWSNHGCALT RGNLTYSVCR
CTHLTNFAIL MQVVPLELAR GHQVALSSIS YVGCSLSVLC LVATLVTFAV LSSVSTIRNQ
RYHIHANLSF AVLVAQVLLL ISFRLEPGTT PCQVMAVLLH YFFLSAFAWM LVEGLHLYSM
VIKVFGSEDS KHRYYYGMGW GFPLLICIIS LSFAMDSYGT SNNCWLSLAS GAIWAFVAPA
LFVIVVNIGI LIAVTRVISQ ISADNYKIHG DPSAFKLTAK AVAVLLPILG TSWVFGVLAV
NGCAVVFQYM FATLNSLQGL FIFLFHCLLN SEVRAAFKHK TKVWSLTSSS ARTSNAKPFH
SDLMNGTRPG MASTKLSPWD KSSHSAHRVD LSAV


Related products :

Catalog number Product name Quantity
EIAAB28476 GPR120,GPR129,G-protein coupled receptor 120,G-protein coupled receptor 129,G-protein coupled receptor GT01,G-protein coupled receptor PGR4,Homo sapiens,Human,O3FAR1,Omega-3 fatty acid receptor 1,PGR4
EIAAB29406 5-oxo-ETE G-protein coupled receptor,GPR170,G-protein coupled receptor 170,G-protein coupled receptor R527,G-protein coupled receptor TG1019,Homo sapiens,Human,OXER1,Oxoeicosanoid receptor 1,TG1019
18-461-10341 Leucine-rich repeat-containing G-protein coupled receptor 5 - Orphan G-protein coupled receptor HG38; G-protein coupled receptor 49; G-protein coupled receptor 67 Polyclonal 0.05 ml
18-461-10342 Leucine-rich repeat-containing G-protein coupled receptor 5 - Orphan G-protein coupled receptor HG38; G-protein coupled receptor 49; G-protein coupled receptor 67 Polyclonal 0.05 ml
EIAAB36500 Gpr106,G-protein coupled receptor 106,G-protein coupled receptor affecting testicular descent,Great,Leucine-rich repeat-containing G-protein coupled receptor 8,Lgr8,Mouse,Mus musculus,Relaxin family p
EIAAB36499 GPR106,G-protein coupled receptor 106,G-protein coupled receptor affecting testicular descent,GREAT,Homo sapiens,Human,Leucine-rich repeat-containing G-protein coupled receptor 8,LGR8,Relaxin family p
18-461-10719 Oxoeicosanoid receptor 1 - G-protein coupled receptor TG1019; 5-oxo-ETE G-protein coupled receptor; G-protein coupled receptor 170; G-protein coupled receptor R527 Polyclonal 0.05 ml
18-461-10430 Oxoeicosanoid receptor 1 - G-protein coupled receptor TG1019; 5-oxo-ETE G-protein coupled receptor; G-protein coupled receptor 170; G-protein coupled receptor R527 Polyclonal 0.05 ml
18-461-10045 Nicotinic acid receptor 2 - G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B Polyclonal 0.05 ml
18-461-10047 Nicotinic acid receptor 2 - G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B Polyclonal 0.05 ml
18-461-10046 Nicotinic acid receptor 2 - G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B Polyclonal 0.05 ml
EIAAB27701 GPR154,GPRA,G-protein coupled receptor 154,G-protein coupled receptor for asthma susceptibility,G-protein coupled receptor PGR14,Homo sapiens,Human,Neuropeptide S receptor,NPSR1,PGR14
EIAAB28720 Bos taurus,Bovine,bRGR1,G protein-coupled receptor RGR1,GPR68,G-protein coupled receptor 68,Ovarian cancer G-protein coupled receptor 1
EIAAB25401 GPR140,GPR168,G-protein coupled receptor 140,G-protein coupled receptor 168,Homo sapiens,Human,Mas-related gene F protein,Mas-related G-protein coupled receptor member F,MRGF,MRGPRF,PSEC0142
EIAAB27655 GPR74,G-protein coupled receptor 74,G-protein coupled receptor HLWAR77,Homo sapiens,Human,Neuropeptide FF receptor 2,Neuropeptide G-protein coupled receptor,NPFF2,NPFFR2,NPGPR
18-461-10710 Probable G-protein coupled receptor 133 - G-protein coupled receptor PGR25 Polyclonal 0.05 ml
EIAAB36674 AGR16,Edg5,Endothelial differentiation G-protein coupled receptor 5,G-protein coupled receptor H218,Rat,Rattus norvegicus,S1P receptor 2,S1P receptor Edg-5,S1P2,S1pr2,Sphingosine 1-phosphate receptor
18-461-10414 G-protein coupled receptor 120 - G-protein coupled receptor PGR4; G-protein coupled receptor GT01; G-protein coupled receptor 129 Polyclonal 0.05 ml
18-461-10413 G-protein coupled receptor 120 - G-protein coupled receptor PGR4; G-protein coupled receptor GT01; G-protein coupled receptor 129 Polyclonal 0.05 ml
18-461-10708 G-protein coupled receptor 120 - G-protein coupled receptor PGR4; G-protein coupled receptor GT01; G-protein coupled receptor 129 Polyclonal 0.05 ml
18-461-10415 G-protein coupled receptor 120 - G-protein coupled receptor PGR4; G-protein coupled receptor GT01; G-protein coupled receptor 129 Polyclonal 0.05 ml
18-461-10811 2-oxoglutarate receptor 1 - Alpha-ketoglutarate receptor 1; G-protein coupled receptor 80; G-protein coupled receptor 99; P2Y purinoceptor 15; P2Y-like nucleotide receptor; P2Y-like GPCR Polyclonal 0.05 ml
18-461-10700 2-oxoglutarate receptor 1 - Alpha-ketoglutarate receptor 1; G-protein coupled receptor 80; G-protein coupled receptor 99; P2Y purinoceptor 15; P2Y-like nucleotide receptor; P2Y-like GPCR Polyclonal 0.05 ml
EIAAB36682 Edg8,Endothelial differentiation G-protein-coupled receptor 8,Nerve growth factor-regulated G-protein-coupled receptor 1,Nrg1,NRG-1,Rat,Rattus norvegicus,S1P receptor 5,S1P receptor Edg-8,S1P5,S1pr5,S
EIAAB25408 Mas-related G-protein coupled receptor member C11,Mas-related G-protein coupled receptor member X1,Mouse,Mrgc11,Mrgprc11,Mrgprx1,Mus musculus,Sensory neuron-specific G-protein coupled receptor 1


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur