Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Alpha-ketoglutarate-dependent dioxygenase FTO (EC 1.14.11.-) (Fat mass and obesity-associated protein)

 FTO_HUMAN               Reviewed;         505 AA.
Q9C0B1; A2RUH1; B2RNS0; Q0P676; Q7Z785;
01-MAY-2007, integrated into UniProtKB/Swiss-Prot.
29-MAY-2007, sequence version 3.
12-SEP-2018, entry version 124.
RecName: Full=Alpha-ketoglutarate-dependent dioxygenase FTO;
EC=1.14.11.- {ECO:0000305|PubMed:22002720};
AltName: Full=Fat mass and obesity-associated protein;
Name=FTO; Synonyms=KIAA1752;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=11214970; DOI=10.1093/dnares/7.6.347;
Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.;
"Prediction of the coding sequences of unidentified human genes. XIX.
The complete sequences of 100 new cDNA clones from brain which code
for large proteins in vitro.";
DNA Res. 7:347-355(2000).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
TISSUE=Brain;
PubMed=15616553; DOI=10.1038/nature03187;
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X.,
Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A.,
Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.,
Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L.,
Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A.,
Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D.,
Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J.,
Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M.,
Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I.,
Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W.,
Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A.,
Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S.,
Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J.,
Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D.,
Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L.,
Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A.,
Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L.,
Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N.,
Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M.,
Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L.,
Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D.,
Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P.,
Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M.,
Rubin E.M., Pennacchio L.A.;
"The sequence and analysis of duplication-rich human chromosome 16.";
Nature 432:988-994(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
TISSUE=Cervix, Eye, and Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
POLYMORPHISM, AND TISSUE SPECIFICITY.
PubMed=17496892; DOI=10.1038/ng2048;
Dina C., Meyre D., Gallina S., Durand E., Korner A., Jacobson P.,
Carlsson L.M.S., Kiess W., Vatin V., Lecoeur C., Delplanque J.,
Vaillant E., Pattou F., Ruiz J., Weill J., Levy-Marchal C., Horber F.,
Potoczna N., Hercberg S., Le Stunff C., Bougneres P., Kovacs P.,
Marre M., Balkau B., Cauchi S., Chevre J.-C., Froguel P.;
"Variation in FTO contributes to childhood obesity and severe adult
obesity.";
Nat. Genet. 39:724-726(2007).
[5]
POLYMORPHISM, AND TISSUE SPECIFICITY.
PubMed=17434869; DOI=10.1126/science.1141634;
Frayling T.M., Timpson N.J., Weedon M.N., Zeggini E., Freathy R.M.,
Lindgren C.M., Perry J.R., Elliott K.S., Lango H., Rayner N.W.,
Shields B., Harries L.W., Barrett J.C., Ellard S., Groves C.J.,
Knight B., Patch A.M., Ness A.R., Ebrahim S., Lawlor D.A., Ring S.M.,
Ben-Shlomo Y., Jarvelin M.-R., Sovio U., Bennett A.J., Melzer D.,
Ferrucci L., Loos R.J., Barroso I., Wareham N.J., Karpe F., Owen K.R.,
Cardon L.R., Walker M., Hitman G.A., Palmer C.N., Doney A.S.,
Morris A.D., Davey-Smith G., Hattersley A.T., McCarthy M.I.;
"A common variant in the FTO gene is associated with body mass index
and predisposes to childhood and adult obesity.";
Science 316:889-894(2007).
[6]
FUNCTION, AND BIOPHYSICOCHEMICAL PROPERTIES.
PubMed=18775698; DOI=10.1016/j.febslet.2008.08.019;
Jia G., Yang C.G., Yang S., Jian X., Yi C., Zhou Z., He C.;
"Oxidative demethylation of 3-methylthymine and 3-methyluracil in
single-stranded DNA and RNA by mouse and human FTO.";
FEBS Lett. 582:3313-3319(2008).
[7]
ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-216, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19608861; DOI=10.1126/science.1175371;
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M.,
Walther T.C., Olsen J.V., Mann M.;
"Lysine acetylation targets protein complexes and co-regulates major
cellular functions.";
Science 325:834-840(2009).
[8]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[9]
FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF 231-HIS--ASP-233, AND
CHARACTERIZATION OF VARIANT GDFD GLN-316.
PubMed=22002720; DOI=10.1038/nchembio.687;
Jia G., Fu Y., Zhao X., Dai Q., Zheng G., Yang Y., Yi C., Lindahl T.,
Pan T., Yang Y.G., He C.;
"N6-methyladenosine in nuclear RNA is a major substrate of the
obesity-associated FTO.";
Nat. Chem. Biol. 7:885-887(2011).
[10]
POLYMORPHISM, AND INVOLVEMENT IN BMIQ14.
PubMed=22982992; DOI=10.1038/nature11401;
Yang J., Loos R.J., Powell J.E., Medland S.E., Speliotes E.K.,
Chasman D.I., Rose L.M., Thorleifsson G., Steinthorsdottir V.,
Maegi R., Waite L., Smith A.V., Yerges-Armstrong L.M., Monda K.L.,
Hadley D., Mahajan A., Li G., Kapur K., Vitart V., Huffman J.E.,
Wang S.R., Palmer C., Esko T., Fischer K., Zhao J.H., Demirkan A.,
Isaacs A., Feitosa M.F., Luan J., Heard-Costa N.L., White C.,
Jackson A.U., Preuss M., Ziegler A., Eriksson J., Kutalik Z., Frau F.,
Nolte I.M., Van Vliet-Ostaptchouk J.V., Hottenga J.J., Jacobs K.B.,
Verweij N., Goel A., Medina-Gomez C., Estrada K., Bragg-Gresham J.L.,
Sanna S., Sidore C., Tyrer J., Teumer A., Prokopenko I., Mangino M.,
Lindgren C.M., Assimes T.L., Shuldiner A.R., Hui J., Beilby J.P.,
McArdle W.L., Hall P., Haritunians T., Zgaga L., Kolcic I.,
Polasek O., Zemunik T., Oostra B.A., Junttila M.J., Groenberg H.,
Schreiber S., Peters A., Hicks A.A., Stephens J., Foad N.S.,
Laitinen J., Pouta A., Kaakinen M., Willemsen G., Vink J.M.,
Wild S.H., Navis G., Asselbergs F.W., Homuth G., John U.,
Iribarren C., Harris T., Launer L., Gudnason V., O'Connell J.R.,
Boerwinkle E., Cadby G., Palmer L.J., James A.L., Musk A.W.,
Ingelsson E., Psaty B.M., Beckmann J.S., Waeber G., Vollenweider P.,
Hayward C., Wright A.F., Rudan I., Groop L.C., Metspalu A., Khaw K.T.,
van Duijn C.M., Borecki I.B., Province M.A., Wareham N.J.,
Tardif J.C., Huikuri H.V., Cupples L.A., Atwood L.D., Fox C.S.,
Boehnke M., Collins F.S., Mohlke K.L., Erdmann J., Schunkert H.,
Hengstenberg C., Stark K., Lorentzon M., Ohlsson C., Cusi D.,
Staessen J.A., Van der Klauw M.M., Pramstaller P.P., Kathiresan S.,
Jolley J.D., Ripatti S., Jarvelin M.R., de Geus E.J., Boomsma D.I.,
Penninx B., Wilson J.F., Campbell H., Chanock S.J., van der Harst P.,
Hamsten A., Watkins H., Hofman A., Witteman J.C., Zillikens M.C.,
Uitterlinden A.G., Rivadeneira F., Zillikens M.C., Kiemeney L.A.,
Vermeulen S.H., Abecasis G.R., Schlessinger D., Schipf S.,
Stumvoll M., Toenjes A., Spector T.D., North K.E., Lettre G.,
McCarthy M.I., Berndt S.I., Heath A.C., Madden P.A., Nyholt D.R.,
Montgomery G.W., Martin N.G., McKnight B., Strachan D.P., Hill W.G.,
Snieder H., Ridker P.M., Thorsteinsdottir U., Stefansson K.,
Frayling T.M., Hirschhorn J.N., Goddard M.E., Visscher P.M.;
"FTO genotype is associated with phenotypic variability of body mass
index.";
Nature 490:267-272(2012).
[11]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-4, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[12]
FUNCTION, AND INVOLVEMENT IN OBESITY.
PubMed=26287746; DOI=10.1056/NEJMoa1502214;
Claussnitzer M., Dankel S.N., Kim K.H., Quon G., Meuleman W.,
Haugen C., Glunk V., Sousa I.S., Beaudry J.L., Puviindran V.,
Abdennur N.A., Liu J., Svensson P.A., Hsu Y.H., Drucker D.J.,
Mellgren G., Hui C.C., Hauner H., Kellis M.;
"FTO obesity variant circuitry and adipocyte browning in humans.";
N. Engl. J. Med. 373:895-907(2015).
[13]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=26458103; DOI=10.1038/nature15377;
Zhou J., Wan J., Gao X., Zhang X., Jaffrey S.R., Qian S.B.;
"Dynamic m(6)A mRNA methylation directs translational control of heat
shock response.";
Nature 526:591-594(2015).
[14]
X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 32-505 IN COMPLEX WITH IRON
IONS; N-OXALYLGLYCINE AND 3-METHYLTHYMIDINE, CATALYTIC ACTIVITY,
FUNCTION, COFACTOR, ACTIVITY REGULATION, MUTAGENESIS OF ARG-96;
TYR-108; PHE-114; GLU-234 AND CYS-392, CIRCULAR DICHROISM, AND DOMAIN.
PubMed=20376003; DOI=10.1038/nature08921;
Han Z., Niu T., Chang J., Lei X., Zhao M., Wang Q., Cheng W., Wang J.,
Feng Y., Chai J.;
"Crystal structure of the FTO protein reveals basis for its substrate
specificity.";
Nature 464:1205-1209(2010).
[15]
VARIANT GDFD GLN-316, AND CHARACTERIZATION OF VARIANT GDFD GLN-316.
PubMed=19559399; DOI=10.1016/j.ajhg.2009.06.002;
Boissel S., Reish O., Proulx K., Kawagoe-Takaki H., Sedgwick B.,
Yeo G.S., Meyre D., Golzio C., Molinari F., Kadhom N., Etchevers H.C.,
Saudek V., Farooqi I.S., Froguel P., Lindahl T., O'Rahilly S.,
Munnich A., Colleaux L.;
"Loss-of-function mutation in the dioxygenase-encoding FTO gene causes
severe growth retardation and multiple malformations.";
Am. J. Hum. Genet. 85:106-111(2009).
[16]
VARIANT GDFD GLN-322.
PubMed=26697951; DOI=10.1002/ajmg.a.37515;
Rohena L., Lawson M., Guzman E., Ganapathi M., Cho M.T.,
Haverfield E., Anyane-Yeboa K.;
"FTO variant associated with malformation syndrome.";
Am. J. Med. Genet. A 170:1023-1028(2016).
[17]
VARIANT PRO-271.
PubMed=26740239; DOI=10.1038/jhg.2015.160;
Caglayan A.O., Tueysuez B., Coskun S., Quon J., Harmanci A.S.,
Baranoski J.F., Baran B., Erson-Omay E.Z., Henegariu O., Mane S.M.,
Bilguevar K., Yasuno K., Guenel M.;
"A patient with a novel homozygous missense mutation in FTO and
concomitant nonsense mutation in CETP.";
J. Hum. Genet. 61:395-403(2016).
[18]
VARIANT GDFD PHE-319, AND CHARACTERIZATION OF VARIANT GDFD PHE-319.
PubMed=26378117; DOI=10.1136/jmedgenet-2015-103399;
Daoud H., Zhang D., McMurray F., Yu A., Luco S.M., Vanstone J.,
Jarinova O., Carson N., Wickens J., Shishodia S., Choi H.,
McDonough M.A., Schofield C.J., Harper M.E., Dyment D.A., Armour C.M.;
"Identification of a pathogenic FTO mutation by next-generation
sequencing in a newborn with growth retardation and developmental
delay.";
J. Med. Genet. 53:200-207(2016).
-!- FUNCTION: Dioxygenase that repairs alkylated DNA and RNA by
oxidative demethylation. Has highest activity towards single-
stranded RNA containing 3-methyluracil, followed by single-
stranded DNA containing 3-methylthymine. Has low demethylase
activity towards single-stranded DNA containing 1-methyladenine or
3-methylcytosine (PubMed:18775698, PubMed:20376003). Specifically
demethylates N(6)-methyladenosine (m6A) RNA, the most prevalent
internal modification of messenger RNA (mRNA) in higher eukaryotes
(PubMed:22002720, PubMed:26458103). Has no activity towards 1-
methylguanine. Has no detectable activity towards double-stranded
DNA. Requires molecular oxygen, alpha-ketoglutarate and iron.
Contributes to the regulation of the global metabolic rate, energy
expenditure and energy homeostasis. Contributes to the regulation
of body size and body fat accumulation (PubMed:18775698,
PubMed:20376003). In particular, it is involved in the regulation
of thermogenesis and the control of adipocyte differentiation into
brown or white fat cells (PubMed:26287746).
{ECO:0000269|PubMed:18775698, ECO:0000269|PubMed:20376003,
ECO:0000269|PubMed:22002720, ECO:0000269|PubMed:26287746,
ECO:0000269|PubMed:26458103}.
-!- CATALYTIC ACTIVITY: N(6)-methyladenosine in mRNA + 2-oxoglutarate
+ O(2) = adenosine in mRNA + formaldehyde + succinate + CO(2).
{ECO:0000305|PubMed:22002720}.
-!- COFACTOR:
Name=Fe(2+); Xref=ChEBI:CHEBI:29033;
Evidence={ECO:0000269|PubMed:20376003};
Note=Binds 1 Fe(2+) ion per subunit.
{ECO:0000269|PubMed:20376003};
-!- ACTIVITY REGULATION: Activated by ascorbate. Inhibited by N-
oxalylglycine, fumarate and succinate (By similarity).
{ECO:0000250}.
-!- BIOPHYSICOCHEMICAL PROPERTIES:
pH dependence:
Optimum pH is 5.5-6. {ECO:0000269|PubMed:18775698};
-!- SUBUNIT: Monomer. May also exist as homodimer (By similarity).
{ECO:0000250}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:22002720,
ECO:0000269|PubMed:26458103}. Nucleus speckle
{ECO:0000269|PubMed:22002720}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q9C0B1-1; Sequence=Displayed;
Name=2;
IsoId=Q9C0B1-2; Sequence=VSP_025004, VSP_025005;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q9C0B1-3; Sequence=VSP_025002, VSP_025006;
Note=No experimental confirmation available.;
Name=4;
IsoId=Q9C0B1-4; Sequence=VSP_025003;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Ubiquitously expressed, with relatively high
expression in adrenal glands and brain; especially in hypothalamus
and pituitary. {ECO:0000269|PubMed:17434869,
ECO:0000269|PubMed:17496892}.
-!- DOMAIN: The 3D-structure of the Fe2OG dioxygenase domain is
similar to that of the Fe2OG dioxygenase domain found in the
bacterial DNA repair dioxygenase alkB and its mammalian orthologs,
but sequence similarity is very low. As a consequence, the domain
is not detected by protein signature databases.
{ECO:0000269|PubMed:20376003}.
-!- POLYMORPHISM: Genetic variations at the FTO locus define the body
mass index quantitative trait locus 14 (BMIQ14) [MIM:612460].
Variance in body mass index is a susceptibility factor for
obesity. {ECO:0000269|PubMed:17434869,
ECO:0000269|PubMed:17496892, ECO:0000269|PubMed:22982992}.
-!- DISEASE: Growth retardation, developmental delay, and facial
dysmorphism (GDFD) [MIM:612938]: A severe polymalformation
syndrome characterized by postnatal growth retardation,
microcephaly, severe psychomotor delay, functional brain deficits
and characteristic facial dysmorphism. In some patients,
structural brain malformations, cardiac defects, genital
anomalies, and cleft palate are observed. Early death occurs by
the age of 3 years. {ECO:0000269|PubMed:19559399,
ECO:0000269|PubMed:22002720, ECO:0000269|PubMed:26378117,
ECO:0000269|PubMed:26697951}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Obesity (OBESITY) [MIM:601665]: A condition characterized
by an increase of body weight beyond the limitation of skeletal
and physical requirements, as the result of excessive accumulation
of body fat. {ECO:0000269|PubMed:26287746}. Note=Disease
susceptibility is associated with variations affecting the gene
represented in this entry. A pathogenic intronic FTO variation
(rs1421085) disrupts an evolutionarily conserved motif for ARID5B
binding. Loss of ARID5B binding results in overexpression of two
genes distal to FTO, IRX3 and IRX5. IRX3 and IRX5 overexpression
shifts pre-adipocytes differentiation from brown to white fat
cells, resulting in increased lipid storage and loss of
mitochondrial thermogenesis. {ECO:0000269|PubMed:26287746}.
-!- SIMILARITY: Belongs to the fto family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAB21843.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AB051539; BAB21843.1; ALT_INIT; mRNA.
EMBL; AC007347; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC007496; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC007909; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC003583; AAH03583.1; -; mRNA.
EMBL; BC030798; AAH30798.1; -; mRNA.
EMBL; BC132892; AAI32893.1; -; mRNA.
EMBL; BC137091; AAI37092.1; -; mRNA.
CCDS; CCDS32448.1; -. [Q9C0B1-1]
RefSeq; NP_001073901.1; NM_001080432.2. [Q9C0B1-1]
UniGene; Hs.528833; -.
PDB; 3LFM; X-ray; 2.50 A; A=32-505.
PDB; 4CXW; X-ray; 3.10 A; A=32-505.
PDB; 4CXX; X-ray; 2.76 A; A=32-505.
PDB; 4CXY; X-ray; 2.65 A; A=32-505.
PDB; 4IDZ; X-ray; 2.46 A; A=32-505.
PDB; 4IE0; X-ray; 2.53 A; A=32-505.
PDB; 4IE4; X-ray; 2.50 A; A=32-505.
PDB; 4IE5; X-ray; 1.95 A; A=32-505.
PDB; 4IE6; X-ray; 2.50 A; A=32-505.
PDB; 4IE7; X-ray; 2.60 A; A=32-505.
PDB; 4QHO; X-ray; 2.37 A; A=32-505.
PDB; 4QKN; X-ray; 2.20 A; A=32-503.
PDB; 4ZS2; X-ray; 2.16 A; A=32-505.
PDB; 4ZS3; X-ray; 2.45 A; A=32-505.
PDB; 5DAB; X-ray; 2.10 A; A=32-505.
PDB; 5F8P; X-ray; 2.20 A; A=32-502.
PDBsum; 3LFM; -.
PDBsum; 4CXW; -.
PDBsum; 4CXX; -.
PDBsum; 4CXY; -.
PDBsum; 4IDZ; -.
PDBsum; 4IE0; -.
PDBsum; 4IE4; -.
PDBsum; 4IE5; -.
PDBsum; 4IE6; -.
PDBsum; 4IE7; -.
PDBsum; 4QHO; -.
PDBsum; 4QKN; -.
PDBsum; 4ZS2; -.
PDBsum; 4ZS3; -.
PDBsum; 5DAB; -.
PDBsum; 5F8P; -.
ProteinModelPortal; Q9C0B1; -.
SMR; Q9C0B1; -.
BioGrid; 122520; 28.
IntAct; Q9C0B1; 9.
STRING; 9606.ENSP00000418823; -.
BindingDB; Q9C0B1; -.
ChEMBL; CHEMBL2331065; -.
iPTMnet; Q9C0B1; -.
PhosphoSitePlus; Q9C0B1; -.
BioMuta; FTO; -.
DMDM; 148841515; -.
EPD; Q9C0B1; -.
MaxQB; Q9C0B1; -.
PaxDb; Q9C0B1; -.
PeptideAtlas; Q9C0B1; -.
PRIDE; Q9C0B1; -.
ProteomicsDB; 79982; -.
ProteomicsDB; 79983; -. [Q9C0B1-2]
ProteomicsDB; 79984; -. [Q9C0B1-3]
ProteomicsDB; 79985; -. [Q9C0B1-4]
DNASU; 79068; -.
Ensembl; ENST00000431610; ENSP00000415636; ENSG00000140718. [Q9C0B1-4]
Ensembl; ENST00000460382; ENSP00000417422; ENSG00000140718. [Q9C0B1-4]
Ensembl; ENST00000463855; ENSP00000417843; ENSG00000140718. [Q9C0B1-2]
Ensembl; ENST00000471389; ENSP00000418823; ENSG00000140718. [Q9C0B1-1]
GeneID; 79068; -.
KEGG; hsa:79068; -.
UCSC; uc002ehr.4; human. [Q9C0B1-1]
CTD; 79068; -.
DisGeNET; 79068; -.
EuPathDB; HostDB:ENSG00000140718.18; -.
GeneCards; FTO; -.
H-InvDB; HIX0013037; -.
H-InvDB; HIX0134382; -.
H-InvDB; HIX0204005; -.
HGNC; HGNC:24678; FTO.
HPA; CAB017123; -.
HPA; HPA041086; -.
HPA; HPA068695; -.
MalaCards; FTO; -.
MIM; 601665; phenotype.
MIM; 610966; gene.
MIM; 612460; phenotype.
MIM; 612938; phenotype.
neXtProt; NX_Q9C0B1; -.
OpenTargets; ENSG00000140718; -.
Orphanet; 210144; Lethal polymalformative syndrome, Boissel type.
PharmGKB; PA152208656; -.
eggNOG; ENOG410IJ5C; Eukaryota.
eggNOG; ENOG4111PKJ; LUCA.
GeneTree; ENSGT00390000017730; -.
HOGENOM; HOG000273870; -.
HOVERGEN; HBG101847; -.
InParanoid; Q9C0B1; -.
KO; K19469; -.
OrthoDB; EOG091G08LA; -.
PhylomeDB; Q9C0B1; -.
TreeFam; TF333296; -.
Reactome; R-HSA-73943; Reversal of alkylation damage by DNA dioxygenases.
ChiTaRS; FTO; human.
GeneWiki; FTO_gene; -.
GenomeRNAi; 79068; -.
PRO; PR:Q9C0B1; -.
Proteomes; UP000005640; Chromosome 16.
Bgee; ENSG00000140718; Expressed in 236 organ(s), highest expression level in forebrain.
CleanEx; HS_FTO; -.
ExpressionAtlas; Q9C0B1; baseline and differential.
Genevisible; Q9C0B1; HS.
GO; GO:0016607; C:nuclear speck; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0043734; F:DNA-N1-methyladenine dioxygenase activity; IDA:UniProtKB.
GO; GO:0008198; F:ferrous iron binding; IDA:UniProtKB.
GO; GO:0035516; F:oxidative DNA demethylase activity; IDA:UniProtKB.
GO; GO:0035515; F:oxidative RNA demethylase activity; IDA:UniProtKB.
GO; GO:1990931; F:RNA N6-methyladenosine dioxygenase activity; IMP:UniProtKB.
GO; GO:0060612; P:adipose tissue development; IEA:Ensembl.
GO; GO:0006307; P:DNA dealkylation involved in DNA repair; IDA:UniProtKB.
GO; GO:0080111; P:DNA demethylation; IDA:BHF-UCL.
GO; GO:0070989; P:oxidative demethylation; IDA:BHF-UCL.
GO; GO:0035552; P:oxidative single-stranded DNA demethylation; IDA:UniProtKB.
GO; GO:0035553; P:oxidative single-stranded RNA demethylation; IDA:UniProtKB.
GO; GO:0090335; P:regulation of brown fat cell differentiation; IMP:UniProtKB.
GO; GO:0010883; P:regulation of lipid storage; IMP:UniProtKB.
GO; GO:0040014; P:regulation of multicellular organism growth; IEA:Ensembl.
GO; GO:0044065; P:regulation of respiratory system process; IEA:Ensembl.
GO; GO:0070350; P:regulation of white fat cell proliferation; IEA:Ensembl.
GO; GO:0042245; P:RNA repair; IDA:BHF-UCL.
GO; GO:0001659; P:temperature homeostasis; IEA:Ensembl.
Gene3D; 1.20.58.1470; -; 1.
Gene3D; 2.60.120.590; -; 1.
InterPro; IPR037151; AlkB-like_sf.
InterPro; IPR032868; FTO.
InterPro; IPR024366; FTO_C.
InterPro; IPR038413; FTO_C_sf.
InterPro; IPR024367; FTO_cat_dom.
PANTHER; PTHR31291; PTHR31291; 1.
Pfam; PF12934; FTO_CTD; 1.
Pfam; PF12933; FTO_NTD; 1.
SMART; SM01223; FTO_NTD; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Complete proteome;
Dioxygenase; Disease mutation; DNA damage; DNA repair; Iron;
Metal-binding; Nucleus; Obesity; Oxidoreductase; Phosphoprotein;
Polymorphism; Reference proteome; RNA repair.
CHAIN 1 505 Alpha-ketoglutarate-dependent dioxygenase
FTO.
/FTId=PRO_0000286163.
REGION 32 327 Fe2OG dioxygenase domain.
REGION 213 224 Loop L1; predicted to block binding of
double-stranded DNA or RNA.
REGION 231 234 Substrate binding.
REGION 316 318 Alpha-ketoglutarate binding.
METAL 231 231 Iron; catalytic.
METAL 233 233 Iron; catalytic.
METAL 307 307 Iron; catalytic.
BINDING 96 96 Substrate.
BINDING 108 108 Substrate.
BINDING 205 205 Alpha-ketoglutarate.
BINDING 295 295 Alpha-ketoglutarate.
BINDING 320 320 Alpha-ketoglutarate.
BINDING 322 322 Alpha-ketoglutarate.
MOD_RES 4 4 Phosphothreonine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 216 216 N6-acetyllysine.
{ECO:0000244|PubMed:19608861}.
VAR_SEQ 1 445 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_025002.
VAR_SEQ 1 399 Missing (in isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_025003.
VAR_SEQ 1 378 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_025004.
VAR_SEQ 379 413 LRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGV -> ME
WRKVSECNSVEPCREVKKWPYRCIHHGKNFSRM (in
isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_025005.
VAR_SEQ 446 455 QNLRREWHAR -> MACQGREECW (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_025006.
VARIANT 271 271 H -> P (found in a patient with
microcephaly, developmental delay,
behavioral abnormalities, dysmorphic
facial features, hypotonia and other
various phenotypic abnormalities; unknown
pathological significance).
{ECO:0000269|PubMed:26740239}.
/FTId=VAR_076423.
VARIANT 316 316 R -> Q (in GDFD; has no residual normal
activity, impaired ability to demethylate
N(6)-methyladenosine RNAs (m6A) RNAs;
dbSNP:rs121918214).
{ECO:0000269|PubMed:19559399,
ECO:0000269|PubMed:22002720}.
/FTId=VAR_063252.
VARIANT 319 319 S -> F (in GDFD; reduced enzyme activity;
dbSNP:rs781028867).
{ECO:0000269|PubMed:26378117}.
/FTId=VAR_075468.
VARIANT 322 322 R -> Q (in GDFD; dbSNP:rs745616565).
{ECO:0000269|PubMed:26697951}.
/FTId=VAR_075469.
VARIANT 405 405 A -> V (in dbSNP:rs16952624).
/FTId=VAR_032078.
MUTAGEN 96 96 R->M,W: Almost abolishes enzyme activity.
{ECO:0000269|PubMed:20376003}.
MUTAGEN 108 108 Y->A: Abolishes enzyme activity.
{ECO:0000269|PubMed:20376003}.
MUTAGEN 114 114 F->D: Perturbs interaction between N-
terminal and C-terminal domains and
strongly reduces enzyme activity.
{ECO:0000269|PubMed:20376003}.
MUTAGEN 231 233 HHD->AHA: Abolishes ability to
demethylate N(6)-methyladenosine RNAs
(m6A) RNAs.
{ECO:0000269|PubMed:22002720}.
MUTAGEN 234 234 E->P: Abolishes enzyme activity.
Abolishes ability to demethylate N(6)-
methyladenosine RNAs (m6A) RNAs; when
associated with Q-322.
{ECO:0000269|PubMed:20376003}.
MUTAGEN 392 392 C->D: Perturbs interaction between N-
terminal and C-terminal domains and
strongly reduces enzyme activity.
{ECO:0000269|PubMed:20376003}.
CONFLICT 316 316 R -> W (in Ref. 1; BAB21843 and 3;
AAH03583/AAH30798/AAI32893).
{ECO:0000305}.
STRAND 35 37 {ECO:0000244|PDB:4QKN}.
HELIX 38 45 {ECO:0000244|PDB:4IE5}.
STRAND 49 52 {ECO:0000244|PDB:4IE5}.
HELIX 54 56 {ECO:0000244|PDB:4IE5}.
HELIX 59 74 {ECO:0000244|PDB:4IE5}.
STRAND 79 85 {ECO:0000244|PDB:4IE5}.
STRAND 88 101 {ECO:0000244|PDB:4IE5}.
STRAND 104 108 {ECO:0000244|PDB:4IE5}.
STRAND 111 114 {ECO:0000244|PDB:4IE5}.
HELIX 130 162 {ECO:0000244|PDB:4IE5}.
HELIX 190 196 {ECO:0000244|PDB:4IE5}.
STRAND 201 207 {ECO:0000244|PDB:4IE5}.
TURN 209 211 {ECO:0000244|PDB:4IE5}.
STRAND 212 214 {ECO:0000244|PDB:3LFM}.
STRAND 219 221 {ECO:0000244|PDB:4IE5}.
STRAND 225 231 {ECO:0000244|PDB:4IE5}.
STRAND 242 248 {ECO:0000244|PDB:4IE5}.
STRAND 271 276 {ECO:0000244|PDB:4IE5}.
STRAND 280 282 {ECO:0000244|PDB:4IE5}.
STRAND 284 288 {ECO:0000244|PDB:4IE5}.
STRAND 293 297 {ECO:0000244|PDB:4IE5}.
HELIX 301 304 {ECO:0000244|PDB:4IE5}.
STRAND 305 310 {ECO:0000244|PDB:4IE5}.
STRAND 316 322 {ECO:0000244|PDB:4IE5}.
STRAND 327 330 {ECO:0000244|PDB:5F8P}.
HELIX 331 342 {ECO:0000244|PDB:4IE5}.
HELIX 361 377 {ECO:0000244|PDB:4IE5}.
HELIX 379 384 {ECO:0000244|PDB:4IE5}.
TURN 385 387 {ECO:0000244|PDB:4IE5}.
HELIX 389 391 {ECO:0000244|PDB:4IE5}.
HELIX 397 422 {ECO:0000244|PDB:4IE5}.
STRAND 423 426 {ECO:0000244|PDB:4IDZ}.
HELIX 428 457 {ECO:0000244|PDB:4IE5}.
HELIX 459 463 {ECO:0000244|PDB:4IE5}.
HELIX 466 468 {ECO:0000244|PDB:4IE5}.
STRAND 482 485 {ECO:0000244|PDB:5DAB}.
HELIX 490 500 {ECO:0000244|PDB:4IE5}.
SEQUENCE 505 AA; 58282 MW; 3498A92C6E6D81B1 CRC64;
MKRTPTAEER EREAKKLRLL EELEDTWLPY LTPKDDEFYQ QWQLKYPKLI LREASSVSEE
LHKEVQEAFL TLHKHGCLFR DLVRIQGKDL LTPVSRILIG NPGCTYKYLN TRLFTVPWPV
KGSNIKHTEA EIAAACETFL KLNDYLQIET IQALEELAAK EKANEDAVPL CMSADFPRVG
MGSSYNGQDE VDIKSRAAYN VTLLNFMDPQ KMPYLKEEPY FGMGKMAVSW HHDENLVDRS
AVAVYSYSCE GPEEESEDDS HLEGRDPDIW HVGFKISWDI ETPGLAIPLH QGDCYFMLDD
LNATHQHCVL AGSQPRFSST HRVAECSTGT LDYILQRCQL ALQNVCDDVD NDDVSLKSFE
PAVLKQGEEI HNEVEFEWLR QFWFQGNRYR KCTDWWCQPM AQLEALWKKM EGVTNAVLHE
VKREGLPVEQ RNEILTAILA SLTARQNLRR EWHARCQSRI ARTLPADQKP ECRPYWEKDD
ASMPLPFDLT DIVSELRGQL LEAKP


Related products :

Catalog number Product name Quantity
ALKBH3-970H Protein Recombinant Human Alpha-Ketoglutarate-Dependent Dioxygenase AlkB Homolog 3, His-tagged 100ug
ALKBH3-970H Protein: Recombinant Human Alpha-Ketoglutarate-Dependent Dioxygenase AlkB Homolog 3, His-tagged 100ug
CSB-EL009054RA Rat Alpha-ketoglutarate-dependent dioxygenase FTO(FTO) ELISA kit 96T
CSB-EL009054HU Human Alpha-ketoglutarate-dependent dioxygenase FTO(FTO) ELISA kit 96T
5871 Alpha-ketoglutarate-dependent dioxygenase alkB homolog2 0.1 mg
5871 Alpha-ketoglutarate-dependent dioxygenase alkB homolog2 0.5 mg
CSB-EL009054RA Rat Alpha-ketoglutarate-dependent dioxygenase FTO(FTO) ELISA kit SpeciesRat 96T
CSB-EL009054MO Mouse Alpha-ketoglutarate-dependent dioxygenase FTO(FTO) ELISA kit 96T
CSB-EL009054MO Mouse Alpha-ketoglutarate-dependent dioxygenase FTO(FTO) ELISA kit SpeciesMouse 96T
CSB-EL009054HU Human Alpha-ketoglutarate-dependent dioxygenase FTO(FTO) ELISA kit SpeciesHuman 96T
ALKB3_RAT Rat ELISA Kit FOR Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 96T
E1090h Human ELISA Kit FOR Probable alpha-ketoglutarate-dependent dioxygenase ABH5 96T
E1111m Mouse ELISA Kit FOR Probable alpha-ketoglutarate-dependent dioxygenase ABH6 96T
CSB-EL001609RA Rat Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3(ALKBH3) ELISA kit 96T
ALKB2_MOUSE Mouse ELISA Kit FOR Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2 96T
ALKB7_HUMAN Human ELISA Kit FOR Probable alpha-ketoglutarate-dependent dioxygenase ABH7 96T
ALKB3_MOUSE Mouse ELISA Kit FOR Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 96T
G0944 Probable alpha-ketoglutarate-dependent dioxygenase ABH6 (ALKBH6), Mouse, ELISA Kit 96T
CSB-EL001609MO Mouse Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3(ALKBH3) ELISA kit 96T
CSB-EL001612MO Mouse Probable alpha-ketoglutarate-dependent dioxygenase ABH6(ALKBH6) ELISA kit 96T
CSB-EL001609HU Human Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3(ALKBH3) ELISA kit 96T
CSB-EL001608HU Human Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2(ALKBH2) ELISA kit 96T
CSB-EL001613MO Mouse Probable alpha-ketoglutarate-dependent dioxygenase ABH7(ALKBH7) ELISA kit 96T
G0939 Probable alpha-ketoglutarate-dependent dioxygenase ABH4 (ALKBH4), Human, ELISA Kit 96T
CSB-EL001609RA Rat Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3(ALKBH3) ELISA kit SpeciesRat 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur