Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Alpha-methylacyl-CoA racemase (EC 5.1.99.4) (2-methylacyl-CoA racemase)

 AMACR_HUMAN             Reviewed;         382 AA.
Q9UHK6; A5YM47; B8Y916; B8Y918; F8W9N1; O43673; Q3KT79; Q96GH1;
Q9Y3Q1;
27-APR-2001, integrated into UniProtKB/Swiss-Prot.
30-NOV-2010, sequence version 2.
20-JUN-2018, entry version 160.
RecName: Full=Alpha-methylacyl-CoA racemase;
EC=5.1.99.4;
AltName: Full=2-methylacyl-CoA racemase;
Name=AMACR;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ASP-175; SER-201;
THR-261 AND LYS-277, SUBCELLULAR LOCATION, AND MICROBODY TARGETING.
PubMed=11060344;
Amery L., Fransen M., De Nys K., Mannaerts G.P., Van Veldhoven P.P.;
"Mitochondrial and peroxisomal targeting of 2-methylacyl-CoA racemase
in humans.";
J. Lipid Res. 41:1752-1759(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT AMACRD PRO-52, VARIANT
CBAS4 PRO-107, VARIANTS SER-201 AND LYS-277, CHARACTERIZATION OF
VARIANT AMACRD PRO-52, AND CHARACTERIZATION OF VARIANT CBAS4 PRO-107.
PubMed=10655068; DOI=10.1038/72861;
Ferdinandusse S., Denis S., Clayton P.T., Graham A., Rees J.E.,
Allen J.T., McLean B.N., Brown A.Y., Vreken P., Waterham H.R.,
Wanders R.J.A.;
"Mutations in the gene encoding peroxisomal alpha-methylacyl-CoA
racemase cause adult-onset sensory motor neuropathy.";
Nat. Genet. 24:188-191(2000).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), AND VARIANTS SER-201 AND
LYS-277.
TISSUE=Prostate cancer;
PubMed=15880524; DOI=10.1002/pros.20277;
Mubiru J.N., Valente A.J., Troyer D.A.;
"A variant of the alpha-methyl-acyl-CoA racemase gene created by a
deletion in exon 5 and its expression in prostate cancer.";
Prostate 65:117-123(2005).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANTS MET-9; ASP-175;
SER-201; THR-261 AND LYS-277.
Albers C., Schmitz W., Conzelmann E.;
"Human alpha-methylacyl-CoA racemase cDNA sequence.";
Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND VARIANT MET-9.
Ouyang B., Leung Y.-K., Wang V., Chung E., Levin L., Bracken B.,
Cheng L., Ho S.-M.;
"Expression of alpha-methylacyl-CoA racemase spliced variants in
normal and malignant prostate tissue.";
Submitted (NOV-2008) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), AND VARIANT MET-9.
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Salivary gland;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15372022; DOI=10.1038/nature02919;
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S.,
Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M.,
She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.,
Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M.,
Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T.,
Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M.,
Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K.,
Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C.,
Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M.,
Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A.,
Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M.,
Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M.,
Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S.,
Richardson P., Lucas S.M., Myers R.M., Rubin E.M.;
"The DNA sequence and comparative analysis of human chromosome 5.";
Nature 431:268-274(2004).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND VARIANT MET-9.
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), AND VARIANT MET-9.
TISSUE=Kidney;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[11]
CHARACTERIZATION.
TISSUE=Liver;
PubMed=7649182; DOI=10.1111/j.1432-1033.1995.tb20766.x;
Schmitz W., Albers C., Fingerhut R., Conzelmann E.;
"Purification and characterization of an alpha-methylacyl-CoA racemase
from human liver.";
Eur. J. Biochem. 231:815-822(1995).
[12]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[13]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25944712; DOI=10.1002/pmic.201400617;
Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M.,
Ayoub D., Lane L., Bairoch A., Van Dorsselaer A., Carapito C.;
"N-terminome analysis of the human mitochondrial proteome.";
Proteomics 15:2519-2524(2015).
[14]
VARIANT CBAS4 PRO-52.
PubMed=12512044; DOI=10.1053/gast.2003.50017;
Setchell K.D.R., Heubi J.E., Bove K.E., O'Connell N.C., Brewsaugh T.,
Steinberg S.J., Moser A., Squires R.H. Jr.;
"Liver disease caused by failure to racemize trihydroxycholestanoic
acid: gene mutation and effect of bile acid therapy.";
Gastroenterology 124:217-232(2003).
-!- FUNCTION: Racemization of 2-methyl-branched fatty acid CoA esters.
Responsible for the conversion of pristanoyl-CoA and C27-bile
acyl-CoAs to their (S)-stereoisomers.
-!- CATALYTIC ACTIVITY: (2S)-2-methylacyl-CoA = (2R)-2-methylacyl-CoA.
-!- PATHWAY: Lipid metabolism; bile acid biosynthesis.
-!- PATHWAY: Lipid metabolism; fatty acid metabolism.
-!- SUBCELLULAR LOCATION: Peroxisome {ECO:0000269|PubMed:11060344}.
Mitochondrion {ECO:0000269|PubMed:11060344}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q9UHK6-1; Sequence=Displayed;
Name=2; Synonyms=IBLi;
IsoId=Q9UHK6-2; Sequence=VSP_037321, VSP_037326;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=3;
IsoId=Q9UHK6-4; Sequence=VSP_037323, VSP_037324;
Name=4;
IsoId=Q9UHK6-5; Sequence=VSP_044875;
Note=Expression is elevated in prostate cancer.;
-!- DISEASE: Alpha-methylacyl-CoA racemase deficiency (AMACRD)
[MIM:614307]: A rare autosomal recessive peroxisomal disorder
characterized by elevated plasma concentrations of pristanic acid
C27-bile-acid intermediates, and adult onset of variable
neurodegenerative symptoms affecting the central and peripheral
nervous systems. Features may include seizures, visual failure,
sensorimotor neuropathy, spasticity, migraine, and white matter
hyperintensities on brain imaging. {ECO:0000269|PubMed:10655068}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-!- DISEASE: Congenital bile acid synthesis defect 4 (CBAS4)
[MIM:214950]: A disorder characterized by the presence of
trihydroxycoprostanic acid in the bile and absence of cholic acid.
Patients manifest neonatal jaundice, intrahepatic cholestasis and
bile duct deficiency. {ECO:0000269|PubMed:10655068,
ECO:0000269|PubMed:12512044}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the CaiB/BaiF CoA-transferase family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=ACL67853.1; Type=Miscellaneous discrepancy; Note=Aberrant splicing.; Evidence={ECO:0000305};
Sequence=ACL67854.1; Type=Miscellaneous discrepancy; Note=Aberrant splicing.; Evidence={ECO:0000305};
Sequence=CAB44062.1; Type=Frameshift; Positions=62, 65, 114; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AJ130733; CAB44062.1; ALT_FRAME; mRNA.
EMBL; AF158378; AAF22610.1; -; mRNA.
EMBL; AY935981; AAY16192.1; -; mRNA.
EMBL; AF047020; AAD10205.1; -; mRNA.
EMBL; FJ498906; ACL67853.1; ALT_SEQ; mRNA.
EMBL; FJ498907; ACL67854.1; ALT_SEQ; mRNA.
EMBL; FJ498908; ACL67855.1; -; mRNA.
EMBL; BT007193; AAP35857.1; -; mRNA.
EMBL; EF560721; ABQ59031.1; -; mRNA.
EMBL; AC139783; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471118; EAX10816.1; -; Genomic_DNA.
EMBL; BC009471; AAH09471.1; -; mRNA.
CCDS; CCDS3902.1; -. [Q9UHK6-1]
CCDS; CCDS3903.1; -. [Q9UHK6-4]
CCDS; CCDS54836.1; -. [Q9UHK6-5]
RefSeq; NP_001161067.1; NM_001167595.1. [Q9UHK6-5]
RefSeq; NP_055139.4; NM_014324.5. [Q9UHK6-1]
RefSeq; NP_976316.1; NM_203382.2. [Q9UHK6-4]
UniGene; Hs.508343; -.
ProteinModelPortal; Q9UHK6; -.
SMR; Q9UHK6; -.
BioGrid; 117134; 7.
ELM; Q9UHK6; -.
STRING; 9606.ENSP00000371517; -.
SwissLipids; SLP:000001289; -.
iPTMnet; Q9UHK6; -.
PhosphoSitePlus; Q9UHK6; -.
BioMuta; AMACR; -.
DMDM; 313104070; -.
EPD; Q9UHK6; -.
PaxDb; Q9UHK6; -.
PeptideAtlas; Q9UHK6; -.
PRIDE; Q9UHK6; -.
ProteomicsDB; 84369; -.
ProteomicsDB; 84370; -. [Q9UHK6-2]
ProteomicsDB; 84371; -. [Q9UHK6-4]
DNASU; 23600; -.
Ensembl; ENST00000335606; ENSP00000334424; ENSG00000242110. [Q9UHK6-1]
Ensembl; ENST00000382072; ENSP00000371504; ENSG00000242110. [Q9UHK6-4]
Ensembl; ENST00000382085; ENSP00000371517; ENSG00000242110. [Q9UHK6-5]
Ensembl; ENST00000506639; ENSP00000427227; ENSG00000242110. [Q9UHK6-2]
GeneID; 23600; -.
KEGG; hsa:23600; -.
UCSC; uc003jig.4; human. [Q9UHK6-1]
CTD; 23600; -.
DisGeNET; 23600; -.
EuPathDB; HostDB:ENSG00000242110.7; -.
GeneCards; AMACR; -.
HGNC; HGNC:451; AMACR.
HPA; CAB001809; -.
HPA; HPA019527; -.
HPA; HPA020912; -.
MalaCards; AMACR; -.
MIM; 214950; phenotype.
MIM; 604489; gene.
MIM; 614307; phenotype.
neXtProt; NX_Q9UHK6; -.
OpenTargets; ENSG00000242110; -.
Orphanet; 79095; Congenital bile acid synthesis defect type 4.
PharmGKB; PA24757; -.
eggNOG; KOG3957; Eukaryota.
eggNOG; COG1804; LUCA.
GeneTree; ENSGT00530000063418; -.
HOGENOM; HOG000219744; -.
HOVERGEN; HBG060891; -.
InParanoid; Q9UHK6; -.
KO; K01796; -.
OMA; YVASWLF; -.
OrthoDB; EOG091G0FPV; -.
PhylomeDB; Q9UHK6; -.
TreeFam; TF314188; -.
BioCyc; MetaCyc:HS01416-MONOMER; -.
BRENDA; 5.1.99.4; 2681.
Reactome; R-HSA-193368; Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol.
Reactome; R-HSA-193775; Synthesis of bile acids and bile salts via 24-hydroxycholesterol.
Reactome; R-HSA-389887; Beta-oxidation of pristanoyl-CoA.
Reactome; R-HSA-9033241; Peroxisomal protein import.
SABIO-RK; Q9UHK6; -.
UniPathway; UPA00199; -.
UniPathway; UPA00221; -.
ChiTaRS; AMACR; human.
GeneWiki; Alpha-methylacyl-CoA_racemase; -.
GenomeRNAi; 23600; -.
PRO; PR:Q9UHK6; -.
Proteomes; UP000005640; Chromosome 5.
Bgee; ENSG00000242110; -.
CleanEx; HS_AMACR; -.
ExpressionAtlas; Q9UHK6; baseline and differential.
Genevisible; Q9UHK6; HS.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
GO; GO:0005739; C:mitochondrion; IDA:UniProtKB.
GO; GO:0005782; C:peroxisomal matrix; TAS:Reactome.
GO; GO:0005777; C:peroxisome; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; IDA:HPA.
GO; GO:0008111; F:alpha-methylacyl-CoA racemase activity; IDA:UniProtKB.
GO; GO:0005102; F:signaling receptor binding; IPI:UniProtKB.
GO; GO:0006699; P:bile acid biosynthetic process; TAS:Reactome.
GO; GO:0008206; P:bile acid metabolic process; IDA:UniProtKB.
GO; GO:0033540; P:fatty acid beta-oxidation using acyl-CoA oxidase; TAS:Reactome.
GO; GO:0006625; P:protein targeting to peroxisome; TAS:Reactome.
Gene3D; 3.40.50.10540; -; 2.
InterPro; IPR003673; CoA-Trfase_fam_III.
InterPro; IPR023606; CoA-Trfase_III_dom_sf.
Pfam; PF02515; CoA_transf_3; 1.
SUPFAM; SSF89796; SSF89796; 1.
1: Evidence at protein level;
Acetylation; Alternative splicing; Complete proteome;
Disease mutation; Intrahepatic cholestasis; Isomerase; Mitochondrion;
Peroxisome; Polymorphism; Reference proteome.
CHAIN 1 382 Alpha-methylacyl-CoA racemase.
/FTId=PRO_0000194705.
MOTIF 380 382 Microbody targeting signal.
ACT_SITE 152 152 Nucleophile. {ECO:0000250}.
MOD_RES 58 58 N6-acetyllysine.
{ECO:0000250|UniProtKB:O09174}.
MOD_RES 87 87 N6-acetyllysine; alternate.
{ECO:0000250|UniProtKB:O09174}.
MOD_RES 87 87 N6-succinyllysine; alternate.
{ECO:0000250|UniProtKB:O09174}.
MOD_RES 268 268 N6-succinyllysine.
{ECO:0000250|UniProtKB:O09174}.
VAR_SEQ 132 229 VLSKIGRSGENPYAPLNLLADFAGGGLMCALGIIMALFDRT
RTGKGQVIDANMVEGTAYLSSFLWKTQKLSLWEAPRGQNML
DGGAPFYTTYRTADGE -> GRNSIFKFFSVENSEIESVGS
TSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQR
SLIPYFNLYLQFLNISMQNLFKVHTLLRPCYFLGQK (in
isoform 2). {ECO:0000303|Ref.5}.
/FTId=VSP_037321.
VAR_SEQ 132 198 VLSKIGRSGENPYAPLNLLADFAGGGLMCALGIIMALFDRT
RTGKGQVIDANMVEGTAYLSSFLWKT -> GRNSIFKFFSV
ENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNR
TPVLRAADQRTWTKV (in isoform 3).
{ECO:0000303|PubMed:15489334,
ECO:0000303|Ref.6}.
/FTId=VSP_037323.
VAR_SEQ 199 382 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334,
ECO:0000303|Ref.6}.
/FTId=VSP_037324.
VAR_SEQ 230 382 Missing (in isoform 2).
{ECO:0000303|Ref.5}.
/FTId=VSP_037326.
VAR_SEQ 378 382 VKASL -> AGSKFWILYPTHSNIQK (in isoform
4). {ECO:0000303|PubMed:15880524}.
/FTId=VSP_044875.
VARIANT 9 9 V -> M (in dbSNP:rs3195676).
{ECO:0000269|PubMed:15489334,
ECO:0000269|Ref.4, ECO:0000269|Ref.5,
ECO:0000269|Ref.6, ECO:0000269|Ref.9}.
/FTId=VAR_010660.
VARIANT 52 52 S -> P (in AMACRD and CBAS4; inactive
enzyme; dbSNP:rs121917814).
{ECO:0000269|PubMed:10655068,
ECO:0000269|PubMed:12512044}.
/FTId=VAR_010661.
VARIANT 107 107 L -> P (in CBAS4; inactive enzyme;
dbSNP:rs121917816).
{ECO:0000269|PubMed:10655068}.
/FTId=VAR_010665.
VARIANT 118 118 R -> Q (in dbSNP:rs16892150).
/FTId=VAR_055616.
VARIANT 175 175 G -> D (in dbSNP:rs10941112).
{ECO:0000269|PubMed:11060344,
ECO:0000269|Ref.4}.
/FTId=VAR_010662.
VARIANT 201 201 L -> S (in dbSNP:rs2287939).
{ECO:0000269|PubMed:10655068,
ECO:0000269|PubMed:11060344,
ECO:0000269|PubMed:15880524,
ECO:0000269|Ref.4}.
/FTId=VAR_010663.
VARIANT 238 238 P -> S (in dbSNP:rs9282594).
/FTId=VAR_055617.
VARIANT 239 239 Q -> H (in dbSNP:rs34677).
/FTId=VAR_055618.
VARIANT 261 261 M -> I (in dbSNP:rs9282593).
/FTId=VAR_055619.
VARIANT 261 261 M -> T (in dbSNP:rs3195678).
{ECO:0000269|PubMed:11060344,
ECO:0000269|Ref.4}.
/FTId=VAR_055620.
VARIANT 277 277 E -> K (in dbSNP:rs2278008).
{ECO:0000269|PubMed:10655068,
ECO:0000269|PubMed:11060344,
ECO:0000269|PubMed:15880524,
ECO:0000269|Ref.4}.
/FTId=VAR_010664.
CONFLICT 18 18 P -> R (in Ref. 1; CAB44062).
{ECO:0000305}.
CONFLICT 128 128 A -> T (in Ref. 7; ABQ59031).
{ECO:0000305}.
CONFLICT 150 150 L -> V (in Ref. 1; CAB44062).
{ECO:0000305}.
CONFLICT 183 183 N -> D (in Ref. 4; AAD10205).
{ECO:0000305}.
CONFLICT 257 257 N -> S (in Ref. 4; AAD10205).
{ECO:0000305}.
CONFLICT 327 327 P -> L (in Ref. 1; CAB44062).
{ECO:0000305}.
CONFLICT 340 342 FKR -> SKG (in Ref. 1; CAB44062).
{ECO:0000305}.
SEQUENCE 382 AA; 42387 MW; E967D3221A90BEF8 CRC64;
MALQGISVVE LSGLAPGPFC AMVLADFGAR VVRVDRPGSR YDVSRLGRGK RSLVLDLKQP
RGAAVLRRLC KRSDVLLEPF RRGVMEKLQL GPEILQRENP RLIYARLSGF GQSGSFCRLA
GHDINYLALS GVLSKIGRSG ENPYAPLNLL ADFAGGGLMC ALGIIMALFD RTRTGKGQVI
DANMVEGTAY LSSFLWKTQK LSLWEAPRGQ NMLDGGAPFY TTYRTADGEF MAVGAIEPQF
YELLIKGLGL KSDELPNQMS MDDWPEMKKK FADVFAEKTK AEWCQIFDGT DACVTPVLTF
EEVVHHDHNK ERGSFITSEE QDVSPRPAPL LLNTPAIPSF KRDPFIGEHT EEILEEFGFS
REEIYQLNSD KIIESNKVKA SL


Related products :

Catalog number Product name Quantity
U0993r CLIA 2-arylpropionyl-CoA epimerase,2-methylacyl-CoA racemase,Alpha-methylacyl-CoA racemase,Amacr,Rat,Rattus norvegicus 96T
E0993r ELISA kit 2-arylpropionyl-CoA epimerase,2-methylacyl-CoA racemase,Alpha-methylacyl-CoA racemase,Amacr,Rat,Rattus norvegicus 96T
E0993r ELISA 2-arylpropionyl-CoA epimerase,2-methylacyl-CoA racemase,Alpha-methylacyl-CoA racemase,Amacr,Rat,Rattus norvegicus 96T
E0993h ELISA 2-methylacyl-CoA racemase,Alpha-methylacyl-CoA racemase,AMACR,Homo sapiens,Human 96T
U0993h CLIA 2-methylacyl-CoA racemase,Alpha-methylacyl-CoA racemase,AMACR,Homo sapiens,Human 96T
E0993m ELISA kit 2-methylacyl-CoA racemase,Alpha-methylacyl-CoA racemase,Amacr,Macr1,Mouse,Mus musculus 96T
E0993m ELISA 2-methylacyl-CoA racemase,Alpha-methylacyl-CoA racemase,Amacr,Macr1,Mouse,Mus musculus 96T
E0993h ELISA kit 2-methylacyl-CoA racemase,Alpha-methylacyl-CoA racemase,AMACR,Homo sapiens,Human 96T
U0993m CLIA 2-methylacyl-CoA racemase,Alpha-methylacyl-CoA racemase,Amacr,Macr1,Mouse,Mus musculus 96T
EH1108 Alpha-methylacyl-CoA racemase Elisa Kit 96T
10-663-45603 Alpha-Methylacyl-CoA Racemase (P504S_AMACR) Human - N_A N_A 0.005 mg
AMBP AMACR Gene alpha-methylacyl-CoA racemase
10-663-45603 Alpha-Methylacyl-CoA Racemase (P504S_AMACR) Human - N_A N_A 0.002 mg
10-663-45603 Alpha-Methylacyl-CoA Racemase (P504S_AMACR) Human - N_A N_A 0.01 mg
RP-778 Recombinant Human P504 alpha Methylacyl CoA Racemase 2 ug
201-20-7157 AMACR_P504S{alpha-methylacyl-CoA racemase}rabbit.pAb 0.1ml
CSB-EL001652RA Rat Alpha-methylacyl-CoA racemase(AMACR) ELISA kit 96T
gen13851 AMACR_MOUSE Alpha-methylacyl-CoA racemase ELISA tesk kit 1
gen13856 AMACR_RAT Alpha-methylacyl-CoA racemase ELISA tesk kit 1
228-11188-1 Recombinant Human P504 _ alpha Methylacyl CoA Racemase 2
228-11188-2 Recombinant Human P504 _ alpha Methylacyl CoA Racemase 5
CSB-EL001652HU Human Alpha-methylacyl-CoA racemase(AMACR) ELISA kit 96T
228-11188-3 Recombinant Human P504 _ alpha Methylacyl CoA Racemase 10
gen13848 AMACR_HUMAN Alpha-methylacyl-CoA racemase ELISA tesk kit 1
CSB-EL001652MO Mouse Alpha-methylacyl-CoA racemase(AMACR) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur