Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Ammonium transporter Rh type B (Rhesus blood group family type B glycoprotein) (Rh family type B glycoprotein) (Rh type B glycoprotein)

 RHBG_CANLF              Reviewed;         458 AA.
Q4VUI0; Q8HYQ5; Q8HYQ6;
03-APR-2007, integrated into UniProtKB/Swiss-Prot.
05-JUL-2005, sequence version 1.
25-OCT-2017, entry version 75.
RecName: Full=Ammonium transporter Rh type B;
AltName: Full=Rhesus blood group family type B glycoprotein;
Short=Rh family type B glycoprotein;
Short=Rh type B glycoprotein;
Name=RHBG;
Canis lupus familiaris (Dog) (Canis familiaris).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;
Canis.
NCBI_TaxID=9615;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
TISSUE=Kidney;
PubMed=16227429; DOI=10.1073/pnas.0507886102;
Huang C.-H., Peng J.;
"Evolutionary conservation and diversification of Rh family genes and
proteins.";
Proc. Natl. Acad. Sci. U.S.A. 102:15512-15517(2005).
-!- FUNCTION: Functions as a specific ammonium transporter.
{ECO:0000250}.
-!- SUBUNIT: Interacts (via C-terminus) with ANK2 and ANK3; required
for targeting to the basolateral membrane. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Basolateral cell membrane {ECO:0000250};
Multi-pass membrane protein {ECO:0000250}. Cytoplasmic vesicle
membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q4VUI0-1; Sequence=Displayed;
Name=2;
IsoId=Q4VUI0-2; Sequence=VSP_024339;
-!- PTM: N-glycosylated. {ECO:0000250}.
-!- SIMILARITY: Belongs to the ammonium transporter (TC 2.A.49)
family. Rh subfamily. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAN76726.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY622224; AAV40851.1; -; mRNA.
EMBL; AF447922; AAN76725.1; -; mRNA.
EMBL; AF447923; AAN76726.1; ALT_INIT; mRNA.
RefSeq; NP_001003017.2; NM_001003017.2. [Q4VUI0-1]
UniGene; Cfa.35; -.
ProteinModelPortal; Q4VUI0; -.
Ensembl; ENSCAFT00000026621; ENSCAFP00000024727; ENSCAFG00000016811. [Q4VUI0-2]
GeneID; 403538; -.
KEGG; cfa:403538; -.
CTD; 57127; -.
GeneTree; ENSGT00390000005787; -.
HOGENOM; HOG000007656; -.
HOVERGEN; HBG004374; -.
InParanoid; Q4VUI0; -.
KO; K06580; -.
OMA; YWEVPGE; -.
Reactome; R-CFA-444411; Rhesus glycoproteins mediate ammonium transport.
Proteomes; UP000002254; Chromosome 7.
Bgee; ENSCAFG00000016811; -.
GO; GO:0016323; C:basolateral plasma membrane; IDA:UniProtKB.
GO; GO:0030659; C:cytoplasmic vesicle membrane; IEA:UniProtKB-SubCell.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0005886; C:plasma membrane; IDA:UniProtKB.
GO; GO:0014731; C:spectrin-associated cytoskeleton; ISS:UniProtKB.
GO; GO:0008519; F:ammonium transmembrane transporter activity; IDA:UniProtKB.
GO; GO:0015696; P:ammonium transport; IDA:UniProtKB.
GO; GO:0015695; P:organic cation transport; IBA:GO_Central.
Gene3D; 1.10.3430.10; -; 1.
InterPro; IPR029020; Ammonium/urea_transptr.
InterPro; IPR024041; NH4_transpt_AmtB-like_dom.
InterPro; IPR002229; RhesusRHD.
Pfam; PF00909; Ammonium_transp; 1.
PRINTS; PR00342; RHESUSRHD.
SUPFAM; SSF111352; SSF111352; 1.
2: Evidence at transcript level;
Alternative splicing; Ammonia transport; Cell membrane;
Complete proteome; Cytoplasmic vesicle; Glycoprotein; Membrane;
Reference proteome; Transmembrane; Transmembrane helix; Transport.
CHAIN 1 458 Ammonium transporter Rh type B.
/FTId=PRO_0000283595.
TOPO_DOM 1 13 Cytoplasmic. {ECO:0000255}.
TRANSMEM 14 34 Helical. {ECO:0000255}.
TOPO_DOM 35 61 Extracellular. {ECO:0000255}.
TRANSMEM 62 82 Helical. {ECO:0000255}.
TOPO_DOM 83 90 Cytoplasmic. {ECO:0000255}.
TRANSMEM 91 111 Helical. {ECO:0000255}.
TOPO_DOM 112 124 Extracellular. {ECO:0000255}.
TRANSMEM 125 145 Helical. {ECO:0000255}.
TOPO_DOM 146 151 Cytoplasmic. {ECO:0000255}.
TRANSMEM 152 172 Helical. {ECO:0000255}.
TOPO_DOM 173 179 Extracellular. {ECO:0000255}.
TRANSMEM 180 200 Helical. {ECO:0000255}.
TOPO_DOM 201 219 Cytoplasmic. {ECO:0000255}.
TRANSMEM 220 240 Helical. {ECO:0000255}.
TOPO_DOM 241 250 Extracellular. {ECO:0000255}.
TRANSMEM 251 273 Helical. {ECO:0000255}.
TOPO_DOM 274 279 Cytoplasmic. {ECO:0000255}.
TRANSMEM 280 302 Helical. {ECO:0000255}.
TOPO_DOM 303 306 Extracellular. {ECO:0000255}.
TRANSMEM 307 329 Helical. {ECO:0000255}.
TOPO_DOM 330 343 Cytoplasmic. {ECO:0000255}.
TRANSMEM 344 364 Helical. {ECO:0000255}.
TOPO_DOM 365 393 Extracellular. {ECO:0000255}.
TRANSMEM 394 414 Helical. {ECO:0000255}.
TOPO_DOM 415 458 Cytoplasmic. {ECO:0000255}.
REGION 416 424 Interaction with ANK3. {ECO:0000250}.
MOTIF 429 432 Basolateral sorting signal.
{ECO:0000250}.
CARBOHYD 49 49 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 63 MARSPRRAGAPRLQLPLLCLLLQGATAILFAVFVRYNHETD
AALWHWGNHSNLDNEFYFRYPS -> MEQHASHPNEKAKEE
SNAVPLCRAKPSPSFINLQASSPPATFLNIQRTKLPSG
(in isoform 2).
{ECO:0000303|PubMed:16227429}.
/FTId=VSP_024339.
SEQUENCE 458 AA; 49523 MW; F966A0DDE22774CA CRC64;
MARSPRRAGA PRLQLPLLCL LLQGATAILF AVFVRYNHET DAALWHWGNH SNLDNEFYFR
YPSFQDVHVM VFVGFGFLMA FLQRYGFSSV GFTFLLAAFA LQWSTLIQGF FHSLHGGYIH
VSVNSMINAD FCAGAVLISF GAILGKTGPA QLLLMTVLEV ALFGINEFVL LNLLQVKDAG
GSMTIHTFGA YFGLVLSRVL YRPQLEKSKH RQCSVYHSDL FAMIGTIFLW IFWPSFNSAP
TTLGDGQHRT ALNTYYSLSA STLGTFAMSA LVGERGRLDM VHIQNAALAG GVVVGTAGEM
MLTPFGALAA GFLAGTVSTL GYKFFTPILE AKFKVQDTCG VHNLHGIPGV LGALLGVLVV
GLATHEAYGE GLGSVFPLIA KGQRTAMSQA MYQLFGLFVT LMFASVGGAL GGLLLKLPCL
GSPADCQCYE DQVYWEVPGE HEDAAQGPLK AEEPDTQA


Related products :

Catalog number Product name Quantity
EIAAB34629 Ammonium transporter Rh type C,C15orf6,CDRC2,Homo sapiens,Human,PDRC2,Rh family type C glycoprotein,Rh glycoprotein kidney,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein,RHG
EIAAB34610 Ammonium transporter Rh type B,Oryctolagus cuniculus,Rabbit,Rh family type B glycoprotein,Rh type B glycoprotein,RHBG,Rhesus blood group family type B glycoprotein
EIAAB34630 Ammonium transporter Rh type C,Oryctolagus cuniculus,Rabbit,Rh family type C glycoprotein,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein
EIAAB34608 Ammonium transporter Rh type B,Homo sapiens,Human,Rh family type B glycoprotein,Rh type B glycoprotein,RHBG,Rhesus blood group family type B glycoprotein
EIAAB34632 Ammonium transporter Rh type C,Mouse,Mus musculus,Rh family type C glycoprotein,Rh type C glycoprotein,Rhcg,Rhesus blood group family type C glycoprotein,Rhesus blood group-associated C glycoprotein,R
EIAAB34596 Ammonium transporter Rh type A,Erythrocyte membrane glycoprotein Rh50,Rat,Rattus norvegicus,Rh family type A glycoprotein,Rh type A glycoprotein,Rh50,Rhag,Rhesus blood group family type A glycoprotein
EIAAB34597 Ammonium transporter Rh type A,Erythrocyte membrane glycoprotein Rh50,Mouse,Mus musculus,Rh family type A glycoprotein,Rh type A glycoprotein,Rh50,Rhag,Rhesus blood group family type A glycoprotein
EIAAB34594 Ammonium transporter Rh type A,Bos taurus,Bovine,Erythrocyte membrane glycoprotein Rh50,Rh family type A glycoprotein,Rh type A glycoprotein,RH50,RHAG,Rhesus blood group family type A glycoprotein
EIAAB34628 Ammonium transporter Rh type C,Rat,Rattus norvegicus,Rh family type C glycoprotein,Rh type C glycoprotein,Rhcg,Rhesus blood group family type C glycoprotein
EIAAB34606 Ammonium transporter Rh type B,Rat,Rattus norvegicus,Rh family type B glycoprotein,Rh type B glycoprotein,Rhbg,Rhesus blood group family type B glycoprotein
EIAAB34631 Ammonium transporter Rh type C,Bos taurus,Bovine,Rh family type C glycoprotein,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein
EIAAB34607 Ammonium transporter Rh type B,Bos taurus,Bovine,Rh family type B glycoprotein,Rh type B glycoprotein,RHBG,Rhesus blood group family type B glycoprotein
EIAAB34609 Ammonium transporter Rh type B,Mouse,Mus musculus,Rh family type B glycoprotein,Rh type B glycoprotein,Rhbg,Rhesus blood group family type B glycoprotein
EIAAB34627 Ammonium transporter Rh type C,Pig,Rh family type C glycoprotein,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein,Sus scrofa
EIAAB34612 Ammonium transporter Rh type B,Pig,Rh family type B glycoprotein,Rh type B glycoprotein,RHBG,Rhesus blood group family type B glycoprotein,Sus scrofa
EIAAB34634 Ammonium transporter Rh type C,Chicken,Gallus gallus,Rh family type C glycoprotein,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein
EIAAB34593 Ammonium transporter Rh type A,Canis familiaris,Canis lupus familiaris,Dog,Erythrocyte membrane glycoprotein Rh50,Rh family type A glycoprotein,Rh type A glycoprotein,RHAG,Rhesus blood group family ty
EIAAB34633 Ammonium transporter Rh type C,Canis familiaris,Canis lupus familiaris,Dog,Rh family type C glycoprotein,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein
EIAAB34611 Ammonium transporter Rh type B,Canis familiaris,Canis lupus familiaris,Dog,Rh family type B glycoprotein,Rh type B glycoprotein,RHBG,Rhesus blood group family type B glycoprotein
EIAAB34595 Ammonium transporter Rh type A,Erythrocyte membrane glycoprotein Rh50,Erythrocyte plasma membrane 50 kDa glycoprotein,Homo sapiens,Human,Rh family type A glycoprotein,Rh type A glycoprotein,RH50,Rh50A
E1464m ELISA kit CD107 antigen-like family member B,Lamp2,LAMP-2,Lamp-2,LGP-B,Lysosomal membrane glycoprotein type B,Lysosome-associated membrane glycoprotein 2,Lysosome-associated membrane protein 2,Mouse, 96T
U1464m CLIA CD107 antigen-like family member B,Lamp2,LAMP-2,Lamp-2,LGP-B,Lysosomal membrane glycoprotein type B,Lysosome-associated membrane glycoprotein 2,Lysosome-associated membrane protein 2,Mouse,Mus mu 96T
E1464m ELISA CD107 antigen-like family member B,Lamp2,LAMP-2,Lamp-2,LGP-B,Lysosomal membrane glycoprotein type B,Lysosome-associated membrane glycoprotein 2,Lysosome-associated membrane protein 2,Mouse,Mus m 96T
E1464r ELISA CD107 antigen-like family member B,Lamp2,LAMP-2,Lamp-2,LGP-110,LGP-96,LGP-B,Lysosomal membrane glycoprotein type B,Lysosome-associated membrane glycoprotein 2,Lysosome-associated membrane protei 96T
U1464r CLIA CD107 antigen-like family member B,Lamp2,LAMP-2,Lamp-2,LGP-110,LGP-96,LGP-B,Lysosomal membrane glycoprotein type B,Lysosome-associated membrane glycoprotein 2,Lysosome-associated membrane protein 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur