Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Ammonium transporter Rh type C 1 (FRhcg1) (Rhesus blood group family type C glycoprotein 1) (RHCG-1) (Rh family type C glycoprotein 1) (Rh type C glycoprotein 1)

 RHCG1_TAKRU             Reviewed;         485 AA.
Q18PF5; Q7T3R5;
03-APR-2007, integrated into UniProtKB/Swiss-Prot.
25-JUL-2006, sequence version 1.
28-FEB-2018, entry version 58.
RecName: Full=Ammonium transporter Rh type C 1;
AltName: Full=FRhcg1;
AltName: Full=Rhesus blood group family type C glycoprotein 1;
Short=RHCG-1;
Short=Rh family type C glycoprotein 1;
Short=Rh type C glycoprotein 1;
Name=rhcg1;
Takifugu rubripes (Japanese pufferfish) (Fugu rubripes).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata;
Eupercaria; Tetraodontiformes; Tetradontoidea; Tetraodontidae;
Takifugu.
NCBI_TaxID=31033;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
PubMed=16227429; DOI=10.1073/pnas.0507886102;
Huang C.-H., Peng J.;
"Evolutionary conservation and diversification of Rh family genes and
proteins.";
Proc. Natl. Acad. Sci. U.S.A. 102:15512-15517(2005).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY,
AND SUBCELLULAR LOCATION.
PubMed=17218543; DOI=10.1096/fj.06-6834com;
Nakada T., Westhoff C.M., Kato A., Hirose S.;
"Ammonia secretion from fish gill depends on a set of Rh
glycoproteins.";
FASEB J. 21:1067-1074(2007).
-!- FUNCTION: Functions as an ammonia transporter. May play a role in
the elimination of ammonia in the gill.
{ECO:0000269|PubMed:17218543}.
-!- SUBUNIT: Homotrimer.
-!- SUBCELLULAR LOCATION: Apical cell membrane
{ECO:0000269|PubMed:17218543}; Multi-pass membrane protein
{ECO:0000269|PubMed:17218543}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q18PF5-1; Sequence=Displayed;
Name=2;
IsoId=Q18PF5-2; Sequence=VSP_024338;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Specifically expressed in the gill by
mitochondria-rich cells. {ECO:0000269|PubMed:17218543}.
-!- SIMILARITY: Belongs to the ammonium transporter (TC 2.A.49)
family. Rh subfamily. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY116075; AAM48578.1; -; mRNA.
EMBL; AB218981; BAE96343.1; -; mRNA.
RefSeq; NP_001027819.1; NM_001032647.1. [Q18PF5-2]
RefSeq; XP_011605548.1; XM_011607246.1. [Q18PF5-1]
UniGene; Tru.1899; -.
ProteinModelPortal; Q18PF5; -.
STRING; 31033.ENSTRUP00000001063; -.
GeneID; 445990; -.
KEGG; tru:445990; -.
CTD; 51458; -.
eggNOG; KOG3796; Eukaryota.
eggNOG; ENOG410XTF8; LUCA.
InParanoid; Q18PF5; -.
KO; K06580; -.
Proteomes; UP000005226; Unplaced.
GO; GO:0016324; C:apical plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0008519; F:ammonium transmembrane transporter activity; IBA:GO_Central.
GO; GO:0072488; P:ammonium transmembrane transport; IBA:GO_Central.
GO; GO:0015695; P:organic cation transport; IBA:GO_Central.
Gene3D; 1.10.3430.10; -; 1.
InterPro; IPR029020; Ammonium/urea_transptr.
InterPro; IPR024041; NH4_transpt_AmtB-like_dom.
InterPro; IPR002229; RhesusRHD.
Pfam; PF00909; Ammonium_transp; 1.
PRINTS; PR00342; RHESUSRHD.
2: Evidence at transcript level;
Alternative splicing; Ammonia transport; Cell membrane;
Complete proteome; Glycoprotein; Membrane; Reference proteome;
Transmembrane; Transmembrane helix; Transport.
CHAIN 1 485 Ammonium transporter Rh type C 1.
/FTId=PRO_0000283587.
TOPO_DOM 1 20 Cytoplasmic. {ECO:0000255}.
TRANSMEM 21 41 Helical. {ECO:0000255}.
TOPO_DOM 42 73 Extracellular. {ECO:0000255}.
TRANSMEM 74 94 Helical. {ECO:0000255}.
TOPO_DOM 95 98 Cytoplasmic. {ECO:0000255}.
TRANSMEM 99 119 Helical. {ECO:0000255}.
TOPO_DOM 120 138 Extracellular. {ECO:0000255}.
TRANSMEM 139 159 Helical. {ECO:0000255}.
TOPO_DOM 160 167 Cytoplasmic. {ECO:0000255}.
TRANSMEM 168 188 Helical. {ECO:0000255}.
TOPO_DOM 189 193 Extracellular. {ECO:0000255}.
TRANSMEM 194 214 Helical. {ECO:0000255}.
TOPO_DOM 215 233 Cytoplasmic. {ECO:0000255}.
TRANSMEM 234 254 Helical. {ECO:0000255}.
TOPO_DOM 255 265 Extracellular. {ECO:0000255}.
TRANSMEM 266 286 Helical. {ECO:0000255}.
TOPO_DOM 287 299 Cytoplasmic. {ECO:0000255}.
TRANSMEM 300 320 Helical. {ECO:0000255}.
TOPO_DOM 321 321 Extracellular. {ECO:0000255}.
TRANSMEM 322 342 Helical. {ECO:0000255}.
TOPO_DOM 343 357 Cytoplasmic. {ECO:0000255}.
TRANSMEM 358 378 Helical. {ECO:0000255}.
TOPO_DOM 379 410 Extracellular. {ECO:0000255}.
TRANSMEM 411 431 Helical. {ECO:0000255}.
TOPO_DOM 432 485 Cytoplasmic. {ECO:0000255}.
CARBOHYD 60 60 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 453 485 LPEDEESAPPILHYNNHMANKDVVDTNFGMEQN -> GIFH
SKATRAAPQCDLVAAETHVCFPNRSNSAWVCFQVQLR (in
isoform 2).
{ECO:0000303|PubMed:16227429}.
/FTId=VSP_024338.
SEQUENCE 485 AA; 53460 MW; CC4FA065797F2778 CRC64;
MGCVQSFRTL CDRPKNTNVR ISLPAVCFVW QIAMIILFGV FIRYDEESDT HWIEHRKKEN
ISSDIENDFY FRYPSFQDVH VMIFVGFGFL MTFLKRYSFG AVGFNFLIAA FGLQWALLMQ
GWFHSLDYTD GKIKIGVESL INADFCVAGC LIAYGAVLGK VSPVQLMVLT LFGITLFAVE
EYIILSLIHA RDAGGSMVIH TFGGYYGLSI SWMLYRPNLD QSSNLQGSVY HSDVFAMIGT
LFLWMFWPSF NSAITDHGDG QHRAAINTYL ALASTVLTTV AISSLFQKHG KLDMVHIQNS
TLAGGVAVGT AAEFMLMPYG SLIVGFCCGI ISTLGYIYLT PFMEKHLKIQ DTCGIHNLHA
MPGVIGGIVG AITAAAASES VYGKEGLINT FDFEGAFKNM VPTKQGGHQA AGLCVAICFG
IGGGIIVGCI LRLPIWGDPA DDNCFNDEPY WELPEDEESA PPILHYNNHM ANKDVVDTNF
GMEQN


Related products :

Catalog number Product name Quantity
EIAAB34629 Ammonium transporter Rh type C,C15orf6,CDRC2,Homo sapiens,Human,PDRC2,Rh family type C glycoprotein,Rh glycoprotein kidney,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein,RHG
EIAAB34630 Ammonium transporter Rh type C,Oryctolagus cuniculus,Rabbit,Rh family type C glycoprotein,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein
EIAAB34631 Ammonium transporter Rh type C,Bos taurus,Bovine,Rh family type C glycoprotein,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein
EIAAB34628 Ammonium transporter Rh type C,Rat,Rattus norvegicus,Rh family type C glycoprotein,Rh type C glycoprotein,Rhcg,Rhesus blood group family type C glycoprotein
EIAAB34632 Ammonium transporter Rh type C,Mouse,Mus musculus,Rh family type C glycoprotein,Rh type C glycoprotein,Rhcg,Rhesus blood group family type C glycoprotein,Rhesus blood group-associated C glycoprotein,R
EIAAB34627 Ammonium transporter Rh type C,Pig,Rh family type C glycoprotein,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein,Sus scrofa
EIAAB34634 Ammonium transporter Rh type C,Chicken,Gallus gallus,Rh family type C glycoprotein,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein
EIAAB34610 Ammonium transporter Rh type B,Oryctolagus cuniculus,Rabbit,Rh family type B glycoprotein,Rh type B glycoprotein,RHBG,Rhesus blood group family type B glycoprotein
EIAAB34608 Ammonium transporter Rh type B,Homo sapiens,Human,Rh family type B glycoprotein,Rh type B glycoprotein,RHBG,Rhesus blood group family type B glycoprotein
EIAAB34633 Ammonium transporter Rh type C,Canis familiaris,Canis lupus familiaris,Dog,Rh family type C glycoprotein,Rh type C glycoprotein,RHCG,Rhesus blood group family type C glycoprotein
EIAAB34596 Ammonium transporter Rh type A,Erythrocyte membrane glycoprotein Rh50,Rat,Rattus norvegicus,Rh family type A glycoprotein,Rh type A glycoprotein,Rh50,Rhag,Rhesus blood group family type A glycoprotein
EIAAB34597 Ammonium transporter Rh type A,Erythrocyte membrane glycoprotein Rh50,Mouse,Mus musculus,Rh family type A glycoprotein,Rh type A glycoprotein,Rh50,Rhag,Rhesus blood group family type A glycoprotein
EIAAB34594 Ammonium transporter Rh type A,Bos taurus,Bovine,Erythrocyte membrane glycoprotein Rh50,Rh family type A glycoprotein,Rh type A glycoprotein,RH50,RHAG,Rhesus blood group family type A glycoprotein
EIAAB34606 Ammonium transporter Rh type B,Rat,Rattus norvegicus,Rh family type B glycoprotein,Rh type B glycoprotein,Rhbg,Rhesus blood group family type B glycoprotein
EIAAB34609 Ammonium transporter Rh type B,Mouse,Mus musculus,Rh family type B glycoprotein,Rh type B glycoprotein,Rhbg,Rhesus blood group family type B glycoprotein
EIAAB34607 Ammonium transporter Rh type B,Bos taurus,Bovine,Rh family type B glycoprotein,Rh type B glycoprotein,RHBG,Rhesus blood group family type B glycoprotein
EIAAB34612 Ammonium transporter Rh type B,Pig,Rh family type B glycoprotein,Rh type B glycoprotein,RHBG,Rhesus blood group family type B glycoprotein,Sus scrofa
EIAAB34593 Ammonium transporter Rh type A,Canis familiaris,Canis lupus familiaris,Dog,Erythrocyte membrane glycoprotein Rh50,Rh family type A glycoprotein,Rh type A glycoprotein,RHAG,Rhesus blood group family ty
EIAAB34611 Ammonium transporter Rh type B,Canis familiaris,Canis lupus familiaris,Dog,Rh family type B glycoprotein,Rh type B glycoprotein,RHBG,Rhesus blood group family type B glycoprotein
EIAAB34595 Ammonium transporter Rh type A,Erythrocyte membrane glycoprotein Rh50,Erythrocyte plasma membrane 50 kDa glycoprotein,Homo sapiens,Human,Rh family type A glycoprotein,Rh type A glycoprotein,RH50,Rh50A
CSB-EL019676RA Rat Rh family, C glycoprotein (RHCG) ELISA kit, Species Rat, Sample Type serum, plasma 96T
CSB-EL019676PI Pig Rh family, C glycoprotein (RHCG) ELISA kit, Species Pig, Sample Type serum, plasma 96T
CSB-EL019676DO Dog Rh family, C glycoprotein (RHCG) ELISA kit, Species Dog, Sample Type serum, plasma 96T
CSB-EL019676BO Bovine Rh family, C glycoprotein (RHCG) ELISA kit, Species Bovine, Sample Type serum, plasma 96T
CSB-EL019676MO Mouse Rh family, C glycoprotein (RHCG) ELISA kit, Species Mouse, Sample Type serum, plasma 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur