Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Annexin A13 (Annexin XIII) (Annexin-13) (Intestine-specific annexin) (ISA)

 ANX13_CANLF             Reviewed;         316 AA.
Q29471; Q29472;
01-NOV-1997, integrated into UniProtKB/Swiss-Prot.
23-JAN-2007, sequence version 2.
12-SEP-2018, entry version 128.
RecName: Full=Annexin A13;
AltName: Full=Annexin XIII;
AltName: Full=Annexin-13;
AltName: Full=Intestine-specific annexin;
Short=ISA;
Name=ANXA13; Synonyms=ANX13;
Canis lupus familiaris (Dog) (Canis familiaris).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;
Canis.
NCBI_TaxID=9615;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B), AND PROTEIN SEQUENCE OF
150-160; 186-199 AND 310-316.
STRAIN=Cocker spaniel; TISSUE=Kidney;
PubMed=7896870; DOI=10.1083/jcb.128.6.1043;
Fiedler K., Lafont F., Parton R.G., Simons K.;
"Annexin XIIIb: a novel epithelial specific annexin is implicated in
vesicular traffic to the apical plasma membrane.";
J. Cell Biol. 128:1043-1053(1995).
-!- FUNCTION: Involved in vesicular traffic to the apical plasma
membrane (isoform B).
-!- SUBCELLULAR LOCATION: Isoform B: Cytoplasmic vesicle.
Note=Enriched in apical vesicles (isoform B).
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=A; Synonyms=Anx13A;
IsoId=Q29471-1; Sequence=Displayed;
Name=B; Synonyms=Anx13B;
IsoId=Q29471-2; Sequence=VSP_000290;
-!- TISSUE SPECIFICITY: Epithelia (isoform A); intestine and kidney
(isoform B).
-!- DOMAIN: A pair of annexin repeats may form one binding site for
calcium and phospholipid.
-!- SIMILARITY: Belongs to the annexin family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; X80208; CAA56506.1; -; mRNA.
EMBL; X80209; CAA56507.1; -; mRNA.
PIR; A57076; A57076.
PIR; B57076; B57076.
RefSeq; NP_001003255.1; NM_001003255.1. [Q29471-2]
RefSeq; XP_005627863.1; XM_005627806.1. [Q29471-1]
UniGene; Cfa.3796; -.
ProteinModelPortal; Q29471; -.
SMR; Q29471; -.
BioGrid; 139851; 1.
STRING; 9615.ENSCAFP00000001437; -.
PaxDb; Q29471; -.
Ensembl; ENSCAFT00000001562; ENSCAFP00000001437; ENSCAFG00000001015. [Q29471-2]
GeneID; 403935; -.
KEGG; cfa:403935; -.
CTD; 312; -.
VGNC; VGNC:37939; ANXA13.
eggNOG; KOG0819; Eukaryota.
eggNOG; ENOG410XPUN; LUCA.
GeneTree; ENSGT00760000118972; -.
HOGENOM; HOG000158803; -.
HOVERGEN; HBG061815; -.
InParanoid; Q29471; -.
KO; K17099; -.
OMA; FQAYQIL; -.
OrthoDB; EOG091G0H6H; -.
TreeFam; TF105452; -.
Proteomes; UP000002254; Chromosome 13.
Bgee; ENSCAFG00000001015; Expressed in 3 organ(s), highest expression level in adult mammalian kidney.
GO; GO:0016324; C:apical plasma membrane; IDA:UniProtKB.
GO; GO:0016323; C:basolateral plasma membrane; IDA:UniProtKB.
GO; GO:0070382; C:exocytic vesicle; IDA:CAFA.
GO; GO:0045121; C:membrane raft; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; IEA:Ensembl.
GO; GO:0005886; C:plasma membrane; IEA:Ensembl.
GO; GO:0005509; F:calcium ion binding; IEA:InterPro.
GO; GO:0005544; F:calcium-dependent phospholipid binding; IEA:UniProtKB-KW.
GO; GO:0042997; P:negative regulation of Golgi to plasma membrane protein transport; IDA:UniProtKB.
GO; GO:0042998; P:positive regulation of Golgi to plasma membrane protein transport; IDA:UniProtKB.
Gene3D; 1.10.220.10; -; 4.
InterPro; IPR001464; Annexin.
InterPro; IPR018502; Annexin_repeat.
InterPro; IPR018252; Annexin_repeat_CS.
InterPro; IPR037104; Annexin_sf.
InterPro; IPR009166; ANX13.
Pfam; PF00191; Annexin; 4.
PRINTS; PR00196; ANNEXIN.
PRINTS; PR01811; ANNEXINXIII.
SMART; SM00335; ANX; 4.
PROSITE; PS00223; ANNEXIN; 3.
1: Evidence at protein level;
Alternative splicing; Annexin; Calcium; Calcium/phospholipid-binding;
Complete proteome; Cytoplasmic vesicle; Direct protein sequencing;
Lipoprotein; Myristate; Reference proteome; Repeat.
INIT_MET 1 1 Removed.
CHAIN 2 316 Annexin A13.
/FTId=PRO_0000067513.
REPEAT 23 83 Annexin 1.
REPEAT 95 155 Annexin 2.
REPEAT 179 239 Annexin 3.
REPEAT 254 314 Annexin 4.
LIPID 2 2 N-myristoyl glycine. {ECO:0000250}.
VAR_SEQ 5 5 H -> HSQSYSLSEGSQQLPKGDIQPSAAVQPLSHPSGSGE
PEAQQP (in isoform B).
{ECO:0000303|PubMed:7896870}.
/FTId=VSP_000290.
SEQUENCE 316 AA; 35479 MW; FD0B34AE0B6C8441 CRC64;
MGNRHAKAKS HHGFDVDHDA KKLNKACKGM GTDEAAIIEI LSSRTSDERQ QIKQKYKATY
GKDLEEVFKS DLSGNFEKTA LALLDRPSEY DARQLQKAMK GLGTDEAVLI EILCTRTNKE
IMAIKEAYQR LFDRSLESDV KADTSGNLKA ILVSLLQANR DEGDDVDKDL AGQDAKDLYD
AGDGRWGTDE LAFNEVLAKR SHKQLRATFQ AYQILIDKDI EEAIEAETSG DLQKAYLTLV
RCARDQEGYF ADRLYKSMKG TGTDEETLIH IIVTRAEVDL QGIKAKFQEK YQKSLSDMVR
SDTSGDFQKL LVALLH


Related products :

Catalog number Product name Quantity
18-003-42803 Annexin A13 - Annexin XIII; Annexin. intestine-specific; ISA Polyclonal 0.1 mg Protein A
18-003-42802 Annexin A13 - Annexin XIII; Annexin. intestine-specific; ISA Polyclonal 0.1 mg Protein A
18-272-196776 Annexin II - Rabbit polyclonal to Annexin II; Annexin-2; Annexin II; Lipocortin II; Calpactin I heavy chain; Chromobindin-8; p36; Protein I; Placental anticoagulant protein IV; PAP-IV Polyclonal 0.1 mg
18-003-44304 Annexin A6 - Annexin-6; Annexin VI; Lipocortin VI; P68; P70; Protein III; Chromobindin-20; 67 kDa calelectrin; Calphobindin-II; CPB-II Polyclonal 0.1 mg Protein A
E1731r ELISA 36 kDa zymogen granule membrane-associated protein,Annexin A4,Annexin IV,Annexin-4,Anx4,Anxa4,Lipocortin IV,Rat,Rattus norvegicus,ZAP36 96T
U1731r CLIA 36 kDa zymogen granule membrane-associated protein,Annexin A4,Annexin IV,Annexin-4,Anx4,Anxa4,Lipocortin IV,Rat,Rattus norvegicus,ZAP36 96T
E1731r ELISA kit 36 kDa zymogen granule membrane-associated protein,Annexin A4,Annexin IV,Annexin-4,Anx4,Anxa4,Lipocortin IV,Rat,Rattus norvegicus,ZAP36 96T
U1731m CLIA Annexin A4,Annexin IV,Annexin-4,Anx4,Anxa4,Mouse,Mus musculus 96T
E1731m ELISA kit Annexin A4,Annexin IV,Annexin-4,Anx4,Anxa4,Mouse,Mus musculus 96T
E1731m ELISA Annexin A4,Annexin IV,Annexin-4,Anx4,Anxa4,Mouse,Mus musculus 96T
28-520 Annexin A7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin A7 gene contains 14 exons and spans approximately 34 kb of DNA. Structural analysis of the 0.1 mg
DL-ANXA11-Hu Human Annexin A11 (ANXA11) ELISA Kit(56 kDa autoantigen,Annexin XI,Annexin-11,Calcyclin-associated annexin 50,CAP-50) 96T
E1731b ELISA 35-beta calcimedin,Annexin A4,Annexin IV,Annexin-4,ANX4,ANXA4,Bos taurus,Bovine,Carbohydrate-binding protein p33_p41,Chromobindin-4,Endonexin I,Lipocortin IV,P32.5,PAP-II,Placental anticoagulant 96T
U1731b CLIA 35-beta calcimedin,Annexin A4,Annexin IV,Annexin-4,ANX4,ANXA4,Bos taurus,Bovine,Carbohydrate-binding protein p33_p41,Chromobindin-4,Endonexin I,Lipocortin IV,P32.5,PAP-II,Placental anticoagulant 96T
E1731b ELISA kit 35-beta calcimedin,Annexin A4,Annexin IV,Annexin-4,ANX4,ANXA4,Bos taurus,Bovine,Carbohydrate-binding protein p33_p41,Chromobindin-4,Endonexin I,Lipocortin IV,P32.5,PAP-II,Placental anticoag 96T
U1731h CLIA 35-beta calcimedin,Annexin A4,Annexin IV,Annexin-4,ANX4,ANXA4,Carbohydrate-binding protein p33_p41,Chromobindin-4,Endonexin I,Homo sapiens,Human,Lipocortin IV,P32.5,PAP-II,Placental anticoagulant 96T
E1731h ELISA 35-beta calcimedin,Annexin A4,Annexin IV,Annexin-4,ANX4,ANXA4,Carbohydrate-binding protein p33_p41,Chromobindin-4,Endonexin I,Homo sapiens,Human,Lipocortin IV,P32.5,PAP-II,Placental anticoagulan 96T
E1731h ELISA kit 35-beta calcimedin,Annexin A4,Annexin IV,Annexin-4,ANX4,ANXA4,Carbohydrate-binding protein p33_p41,Chromobindin-4,Endonexin I,Homo sapiens,Human,Lipocortin IV,P32.5,PAP-II,Placental anticoa 96T
15-288-22296 Annexin A9 - Annexin-31; Annexin XXXI; Pemphaxin Polyclonal 0.1 mg
18-003-42800 Annexin A11 - Annexin XI; Calcyclin-associated annexin 50; CAP-50; 56 kDa autoantigen Polyclonal 0.1 mg Protein A
15-288-22296 Annexin A9 - Annexin-31; Annexin XXXI; Pemphaxin Polyclonal 0.05 mg
25-366 Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have b 0.05 mg
28-552 Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have 0.1 mg
E1731p ELISA 35-beta calcimedin,Annexin A4,Annexin IV,Annexin-4,ANX4,ANXA4,Chromobindin-4,Endonexin I,Lipocortin IV,P32.5,PAP-II,Pig,Placental anticoagulant protein II,PP4-X,Protein II,Sus scrofa 96T
U1731p CLIA 35-beta calcimedin,Annexin A4,Annexin IV,Annexin-4,ANX4,ANXA4,Chromobindin-4,Endonexin I,Lipocortin IV,P32.5,PAP-II,Pig,Placental anticoagulant protein II,PP4-X,Protein II,Sus scrofa 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur