Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Anti-Muellerian hormone type-2 receptor (EC 2.7.11.30) (Anti-Muellerian hormone type II receptor) (AMH type II receptor) (MIS type II receptor) (MISRII) (MRII)

 AMHR2_HUMAN             Reviewed;         573 AA.
Q16671; A0AVE1; B9EGB7; E9PGD2; F8W1D2; Q13762; Q647K2;
01-DEC-2000, integrated into UniProtKB/Swiss-Prot.
01-NOV-1996, sequence version 1.
22-NOV-2017, entry version 181.
RecName: Full=Anti-Muellerian hormone type-2 receptor;
EC=2.7.11.30;
AltName: Full=Anti-Muellerian hormone type II receptor;
Short=AMH type II receptor;
AltName: Full=MIS type II receptor;
Short=MISRII;
Short=MRII;
Flags: Precursor;
Name=AMHR2; Synonyms=AMHR, MISR2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=7493017; DOI=10.1038/ng1295-382;
Imbeaud S., Faure E., Lamarre I., Mattei M.-G., di Clemente N.,
Tizard R., Carre-Eusebe D., Belville C., Tragethon L., Tonkin C.,
Nelson J., McAuliffe M., Bidart J.-M., Lababidi A., Josso N.,
Cate R.L., Picard J.-Y.;
"Insensitivity to anti-Muellerian hormone due to a mutation in the
human anti-Muellerian hormone receptor.";
Nat. Genet. 11:382-388(1995).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=7488027; DOI=10.1006/bbrc.1995.2567;
Visser J.A., McLuskey A., van Beers T., Weghuis D.O., van Kessel A.G.,
Grootegoed J.A., Themmen A.P.N.;
"Structure and chromosomal localization of the human anti-Muellerian
hormone type II receptor gene.";
Biochem. Biophys. Res. Commun. 215:1029-1036(1995).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Testis;
PubMed=10589763;
Masiakos P.T., MacLaughlin D.T., Maheswaran S., Teixeira J.,
Fuller A.F. Jr., Shah P.C., Kehas D.J., Kenneally M.K.,
Dombkowski D.M., Ha T.U., Preffer F.I., Donahoe P.K.;
"Human ovarian cancer, cell lines, and primary ascites cells express
the human Muellerian inhibiting substance (MIS) type II receptor,
bind, and are responsive to MIS.";
Clin. Cancer Res. 5:3488-3499(1999).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), AND VARIANT HIS-319.
Li H., Ke R., Shen C., Zhou G., Zhong G., Lin L., Yang S.;
Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Testis;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16541075; DOI=10.1038/nature04569;
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y.,
Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C.,
Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M.,
Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L.,
Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B.,
Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D.,
Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z.,
Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z.,
Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H.,
Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H.,
Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V.,
Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J.,
Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A.,
Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M.,
Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E.,
Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K.,
Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D.,
Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M.,
Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R.,
Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J.,
Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C.,
Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M.,
Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M.,
Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P.,
Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L.,
Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E.,
Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C.,
Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F.,
Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M.,
Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S.,
Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J.,
Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A.,
Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M.,
Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I.,
Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A.,
Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D.,
Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I.,
Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T.,
Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S.,
Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D.,
Kucherlapati R., Weinstock G., Gibbs R.A.;
"The finished DNA sequence of human chromosome 12.";
Nature 440:346-351(2006).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
VARIANTS PMDS2 CYS-54; VAL-142; GLN-282; GLY-426; 445-GLY--LEU-453
DEL; ALA-458; HIS-491 AND CYS-504.
PubMed=8872466; DOI=10.1093/hmg/5.9.1269;
Imbeaud S., Belville C., Messika-Zeitoun L., Rey R., di Clemente N.,
Josso N., Picard J.-Y.;
"A 27 base-pair deletion of the anti-Muellerian type II receptor gene
is the most common cause of the persistent Muellerian duct syndrome.";
Hum. Mol. Genet. 5:1269-1277(1996).
[9]
VARIANT PMDS2 GLN-406.
PubMed=11549681; DOI=10.1210/jcem.86.9.7839;
Messika-Zeitoun L., Gouedard L., Belville C., Dutertre M., Lins L.,
Imbeaud S., Hughes I.A., Picard J.-Y., Josso N., di Clemente N.;
"Autosomal recessive segregation of a truncating mutation of anti-
Muellerian type II receptor in a family affected by the persistent
Muellerian duct syndrome contrasts with its dominant negative activity
in vitro.";
J. Clin. Endocrinol. Metab. 86:4390-4397(2001).
-!- FUNCTION: On ligand binding, forms a receptor complex consisting
of two type II and two type I transmembrane serine/threonine
kinases. Type II receptors phosphorylate and activate type I
receptors which autophosphorylate, then bind and activate SMAD
transcriptional regulators. Receptor for anti-Muellerian hormone.
-!- CATALYTIC ACTIVITY: ATP + [receptor-protein] = ADP + [receptor-
protein] phosphate.
-!- COFACTOR:
Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250};
Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250};
-!- INTERACTION:
P08238:HSP90AB1; NbExp=2; IntAct=EBI-6423788, EBI-352572;
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane
protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q16671-1; Sequence=Displayed;
Name=2;
IsoId=Q16671-2; Sequence=VSP_044548;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q16671-3; Sequence=VSP_045281;
-!- DISEASE: Persistent Muellerian duct syndrome 2 (PMDS2)
[MIM:261550]: A form of male pseudohermaphroditism characterized
by a failure of Muellerian duct regression in otherwise normal
males. {ECO:0000269|PubMed:11549681, ECO:0000269|PubMed:8872466}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-!- SIMILARITY: Belongs to the protein kinase superfamily. TKL Ser/Thr
protein kinase family. TGFB receptor subfamily. {ECO:0000305}.
-!- WEB RESOURCE: Name=Wikipedia; Note=Anti-Mullerian hormone entry;
URL="https://en.wikipedia.org/wiki/Anti-m%C3%BCllerian_hormone";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X89013; CAA61418.1; -; Genomic_DNA.
EMBL; U29700; AAC50328.1; -; Genomic_DNA.
EMBL; X91156; CAA62593.1; -; Genomic_DNA.
EMBL; X91157; CAA62593.1; JOINED; Genomic_DNA.
EMBL; X91158; CAA62593.1; JOINED; Genomic_DNA.
EMBL; X91159; CAA62593.1; JOINED; Genomic_DNA.
EMBL; X91160; CAA62593.1; JOINED; Genomic_DNA.
EMBL; X91161; CAA62593.1; JOINED; Genomic_DNA.
EMBL; X91162; CAA62593.1; JOINED; Genomic_DNA.
EMBL; X91163; CAA62593.1; JOINED; Genomic_DNA.
EMBL; X91164; CAA62593.1; JOINED; Genomic_DNA.
EMBL; X91165; CAA62593.1; JOINED; Genomic_DNA.
EMBL; X91166; CAA62593.1; JOINED; Genomic_DNA.
EMBL; AF172932; AAD48497.1; -; mRNA.
EMBL; AY714878; AAU21221.1; -; mRNA.
EMBL; AK313593; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AC068889; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC126316; AAI26317.1; -; mRNA.
EMBL; BC136356; AAI36357.1; -; mRNA.
CCDS; CCDS53798.1; -. [Q16671-3]
CCDS; CCDS55829.1; -. [Q16671-2]
CCDS; CCDS8858.1; -. [Q16671-1]
PIR; JC4335; JC4335.
RefSeq; NP_001158162.1; NM_001164690.2. [Q16671-2]
RefSeq; NP_001158163.1; NM_001164691.2. [Q16671-3]
RefSeq; NP_065434.1; NM_020547.3. [Q16671-1]
UniGene; Hs.659889; -.
ProteinModelPortal; Q16671; -.
SMR; Q16671; -.
BioGrid; 106766; 20.
IntAct; Q16671; 4.
STRING; 9606.ENSP00000257863; -.
DrugBank; DB00171; Adenosine triphosphate.
iPTMnet; Q16671; -.
PhosphoSitePlus; Q16671; -.
BioMuta; AMHR2; -.
DMDM; 9087133; -.
PaxDb; Q16671; -.
PeptideAtlas; Q16671; -.
PRIDE; Q16671; -.
DNASU; 269; -.
Ensembl; ENST00000257863; ENSP00000257863; ENSG00000135409. [Q16671-1]
Ensembl; ENST00000379791; ENSP00000369117; ENSG00000135409. [Q16671-3]
Ensembl; ENST00000550311; ENSP00000446661; ENSG00000135409. [Q16671-2]
GeneID; 269; -.
KEGG; hsa:269; -.
UCSC; uc001scx.2; human. [Q16671-1]
CTD; 269; -.
DisGeNET; 269; -.
EuPathDB; HostDB:ENSG00000135409.10; -.
GeneCards; AMHR2; -.
HGNC; HGNC:465; AMHR2.
HPA; HPA060228; -.
HPA; HPA069636; -.
MalaCards; AMHR2; -.
MIM; 261550; phenotype.
MIM; 600956; gene.
neXtProt; NX_Q16671; -.
OpenTargets; ENSG00000135409; -.
Orphanet; 2856; Persistent Mullerian duct syndrome.
PharmGKB; PA24770; -.
eggNOG; KOG3653; Eukaryota.
eggNOG; ENOG410XS2Z; LUCA.
GeneTree; ENSGT00900000140999; -.
HOGENOM; HOG000033920; -.
HOVERGEN; HBG097461; -.
InParanoid; Q16671; -.
KO; K04672; -.
OMA; CCFGIWN; -.
OrthoDB; EOG091G05X7; -.
PhylomeDB; Q16671; -.
TreeFam; TF314724; -.
BRENDA; 2.7.10.2; 2681.
Reactome; R-HSA-201451; Signaling by BMP.
SignaLink; Q16671; -.
SIGNOR; Q16671; -.
GenomeRNAi; 269; -.
PRO; PR:Q16671; -.
Proteomes; UP000005640; Chromosome 12.
Bgee; ENSG00000135409; -.
CleanEx; HS_AMHR2; -.
ExpressionAtlas; Q16671; baseline and differential.
Genevisible; Q16671; HS.
GO; GO:0005887; C:integral component of plasma membrane; IEA:Ensembl.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:1990272; F:anti-Mullerian hormone receptor activity; IEA:Ensembl.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0042562; F:hormone binding; IPI:UniProtKB.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0004872; F:receptor activity; IMP:UniProtKB.
GO; GO:0004702; F:signal transducer, downstream of receptor, with serine/threonine kinase activity; IEA:InterPro.
GO; GO:0005026; F:transforming growth factor beta receptor activity, type II; IEA:Ensembl.
GO; GO:0030509; P:BMP signaling pathway; TAS:Reactome.
GO; GO:0008585; P:female gonad development; IEA:Ensembl.
GO; GO:0008584; P:male gonad development; IEA:Ensembl.
GO; GO:0001880; P:Mullerian duct regression; NAS:UniProtKB.
GO; GO:1902613; P:negative regulation of anti-Mullerian hormone signaling pathway; IEA:Ensembl.
GO; GO:0007548; P:sex differentiation; ISS:UniProtKB.
GO; GO:0007165; P:signal transduction; IMP:UniProtKB.
GO; GO:0007179; P:transforming growth factor beta receptor signaling pathway; IEA:Ensembl.
InterPro; IPR000472; Activin_recp.
InterPro; IPR015771; Anti-muellerian_hrmn_rcpt_II.
InterPro; IPR011009; Kinase-like_dom_sf.
InterPro; IPR000719; Prot_kinase_dom.
InterPro; IPR000333; TGFB_receptor.
PANTHER; PTHR23255; PTHR23255; 1.
Pfam; PF01064; Activin_recp; 1.
Pfam; PF00069; Pkinase; 1.
PIRSF; PIRSF037392; AMHRII; 1.
SUPFAM; SSF56112; SSF56112; 1.
PROSITE; PS50011; PROTEIN_KINASE_DOM; 1.
1: Evidence at protein level;
Alternative splicing; ATP-binding; Complete proteome;
Disease mutation; Disulfide bond; Glycoprotein; Kinase; Magnesium;
Manganese; Membrane; Metal-binding; Nucleotide-binding; Polymorphism;
Pseudohermaphroditism; Receptor; Reference proteome;
Serine/threonine-protein kinase; Signal; Transferase; Transmembrane;
Transmembrane helix.
SIGNAL 1 17 {ECO:0000255}.
CHAIN 18 573 Anti-Muellerian hormone type-2 receptor.
/FTId=PRO_0000024408.
TOPO_DOM 18 149 Extracellular. {ECO:0000255}.
TRANSMEM 150 170 Helical. {ECO:0000255}.
TOPO_DOM 171 573 Cytoplasmic. {ECO:0000255}.
DOMAIN 203 518 Protein kinase. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
NP_BIND 209 217 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
ACT_SITE 333 333 Proton acceptor. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
BINDING 230 230 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
CARBOHYD 66 66 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 119 119 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 55 79 {ECO:0000250|UniProtKB:P37023}.
DISULFID 92 109 {ECO:0000250|UniProtKB:P37023}.
VAR_SEQ 381 475 Missing (in isoform 3).
{ECO:0000303|Ref.4}.
/FTId=VSP_045281.
VAR_SEQ 430 573 DSSPPPFQLAYEAELGNTPTSDELWALAVQERRRPYIPSTW
RCFATDPDGLRELLEDCWDADPEARLTAECVQQRLAALAHP
QESHPFPESCPRGCPPLCPEDCTSIPAPTILPCRPQRSACH
FSVQQGPCSRNPQPACTLSPV -> AVHHPSNWPMRQNWAI
PLPLMSYGPWQCRRGGVPTSHPPGAALPQTLMG (in
isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_044548.
VARIANT 54 54 R -> C (in PMDS2; dbSNP:rs534999427).
{ECO:0000269|PubMed:8872466}.
/FTId=VAR_015525.
VARIANT 142 142 G -> V (in PMDS2).
{ECO:0000269|PubMed:8872466}.
/FTId=VAR_015526.
VARIANT 282 282 H -> Q (in PMDS2; dbSNP:rs539695176).
{ECO:0000269|PubMed:8872466}.
/FTId=VAR_015527.
VARIANT 319 319 R -> H (in dbSNP:rs144236183).
{ECO:0000269|Ref.4}.
/FTId=VAR_069048.
VARIANT 406 406 R -> Q (in PMDS2; dbSNP:rs137853104).
{ECO:0000269|PubMed:11549681}.
/FTId=VAR_015528.
VARIANT 426 426 D -> G (in PMDS2).
{ECO:0000269|PubMed:8872466}.
/FTId=VAR_015529.
VARIANT 445 453 Missing (in PMDS2).
{ECO:0000269|PubMed:8872466}.
/FTId=VAR_031057.
VARIANT 458 458 V -> A (in PMDS2; dbSNP:rs775889926).
{ECO:0000269|PubMed:8872466}.
/FTId=VAR_015530.
VARIANT 491 491 D -> H (in PMDS2; dbSNP:rs780680518).
{ECO:0000269|PubMed:8872466}.
/FTId=VAR_015531.
VARIANT 504 504 R -> C (in PMDS2; dbSNP:rs772294564).
{ECO:0000269|PubMed:8872466}.
/FTId=VAR_015532.
CONFLICT 121 121 S -> N (in Ref. 4; AAU21221).
{ECO:0000305}.
CONFLICT 161 161 L -> V (in Ref. 2; CAA62593).
{ECO:0000305}.
CONFLICT 501 501 V -> A (in Ref. 4; AAU21221).
{ECO:0000305}.
SEQUENCE 573 AA; 62750 MW; 1347C10C2942FDBA CRC64;
MLGSLGLWAL LPTAVEAPPN RRTCVFFEAP GVRGSTKTLG ELLDTGTELP RAIRCLYSRC
CFGIWNLTQD RAQVEMQGCR DSDEPGCESL HCDPSPRAHP SPGSTLFTCS CGTDFCNANY
SHLPPPGSPG TPGSQGPQAA PGESIWMALV LLGLFLLLLL LLGSIILALL QRKNYRVRGE
PVPEPRPDSG RDWSVELQEL PELCFSQVIR EGGHAVVWAG QLQGKLVAIK AFPPRSVAQF
QAERALYELP GLQHDHIVRF ITASRGGPGR LLSGPLLVLE LHPKGSLCHY LTQYTSDWGS
SLRMALSLAQ GLAFLHEERW QNGQYKPGIA HRDLSSQNVL IREDGSCAIG DLGLALVLPG
LTQPPAWTPT QPQGPAAIME AGTQRYMAPE LLDKTLDLQD WGMALRRADI YSLALLLWEI
LSRCPDLRPD SSPPPFQLAY EAELGNTPTS DELWALAVQE RRRPYIPSTW RCFATDPDGL
RELLEDCWDA DPEARLTAEC VQQRLAALAH PQESHPFPES CPRGCPPLCP EDCTSIPAPT
ILPCRPQRSA CHFSVQQGPC SRNPQPACTL SPV


Related products :

Catalog number Product name Quantity
CSB-EL001667RA Rat Anti-Muellerian hormone type-2 receptor(AMHR2) ELISA kit 96T
E1075d Rabbit ELISA Kit FOR Anti-Muellerian hormone type-2 receptor 96T
CSB-EL001667HU Human Anti-Muellerian hormone type-2 receptor(AMHR2) ELISA kit 96T
CSB-EL001667RA Rat Anti-Muellerian hormone type-2 receptor(AMHR2) ELISA kit SpeciesRat 96T
CSB-EL001667MO Mouse Anti-Muellerian hormone type-2 receptor(AMHR2) ELISA kit 96T
CSB-EL001667RB Rabbit Anti-Muellerian hormone type-2 receptor(AMHR2) ELISA kit SpeciesRabbit 96T
CSB-EL001667MO Mouse Anti-Muellerian hormone type-2 receptor(AMHR2) ELISA kit SpeciesMouse 96T
CSB-EL001667HU Human Anti-Muellerian hormone type-2 receptor(AMHR2) ELISA kit SpeciesHuman 96T
EIAAB32990 Parathyroid hormone 1 receptor,Parathyroid hormone_parathyroid hormone-related peptide receptor,PTH_PTHr receptor,PTH_PTHrP type I receptor,PTH1 receptor,Pth1r,Pthr,Pthr1,Rat,Rattus norvegicus
EIAAB32987 Mouse,Mus musculus,Parathyroid hormone 1 receptor,Parathyroid hormone_parathyroid hormone-related peptide receptor,PTH_PTHr receptor,PTH_PTHrP type I receptor,PTH1 receptor,Pth1r,Pthr,Pthr1
EIAAB32991 Homo sapiens,Human,Parathyroid hormone 1 receptor,Parathyroid hormone_parathyroid hormone-related peptide receptor,PTH_PTHr receptor,PTH_PTHrP type I receptor,PTH1 receptor,PTH1R,PTHR,PTHR1
EIAAB32988 Parathyroid hormone 1 receptor,Parathyroid hormone_parathyroid hormone-related peptide receptor,Pig,PTH_PTHr receptor,PTH_PTHrP type I receptor,PTH1 receptor,PTH1R,PTHR,PTHR1,Sus scrofa
EIAAB32989 Bos taurus,Bovine,Parathyroid hormone 1 receptor,Parathyroid hormone_parathyroid hormone-related peptide receptor,PTH_PTHr receptor,PTH_PTHrP type I receptor,PTH1 receptor,PTH1R,PTHR1
18-783-77149 RABBIT ANTI PARATHYROID HORMONE RECEPTOR 1 - PTHR1; PTH_PTHr receptor; PTH_PTHrP type I receptor Polyclonal 1 ml
18-783-77148 RABBIT ANTI HUMAN PARATHYROID HORMONE RECEPTOR 1 - PTHR1; PTH_PTHr receptor; PTH_PTHrP type I receptor Polyclonal 1 ml
U0228h CLIA AMH,AMH,Anti-Muellerian hormone,Homo sapiens,Human,MIF,MIS,Muellerian-inhibiting factor,Muellerian-inhibiting substance 96T
E0228h ELISA kit AMH,AMH,Anti-Muellerian hormone,Homo sapiens,Human,MIF,MIS,Muellerian-inhibiting factor,Muellerian-inhibiting substance 96T
E0228h ELISA AMH,AMH,Anti-Muellerian hormone,Homo sapiens,Human,MIF,MIS,Muellerian-inhibiting factor,Muellerian-inhibiting substance 96T
E0228r ELISA kit AMH,Amh,Anti-Muellerian hormone,MIS,Muellerian-inhibiting factor,Muellerian-inhibiting substance,Rat,Rattus norvegicus 96T
U0228b CLIA AMH,AMH,Anti-Muellerian hormone,Bos taurus,Bovine,MIS,Muellerian-inhibiting factor,Muellerian-inhibiting substance 96T
E0228b ELISA kit AMH,AMH,Anti-Muellerian hormone,Bos taurus,Bovine,MIS,Muellerian-inhibiting factor,Muellerian-inhibiting substance 96T
E0228r ELISA AMH,Amh,Anti-Muellerian hormone,MIS,Muellerian-inhibiting factor,Muellerian-inhibiting substance,Rat,Rattus norvegicus 96T
E0228b ELISA AMH,AMH,Anti-Muellerian hormone,Bos taurus,Bovine,MIS,Muellerian-inhibiting factor,Muellerian-inhibiting substance 96T
E0228m ELISA kit AMH,Amh,Anti-Muellerian hormone,MIS,Mouse,Muellerian-inhibiting factor,Muellerian-inhibiting substance,Mus musculus 96T
U0228r CLIA AMH,Amh,Anti-Muellerian hormone,MIS,Muellerian-inhibiting factor,Muellerian-inhibiting substance,Rat,Rattus norvegicus 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur