Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Appetite-regulating hormone (Growth hormone secretagogue) (Growth hormone-releasing peptide) (Motilin-related peptide) (Protein M46) [Cleaved into: Ghrelin-27; Ghrelin-28 (Ghrelin); Obestatin]

 GHRL_HUMAN              Reviewed;         117 AA.
Q9UBU3; A8CF34; A8CF38; A8CF42; A8DN29; A8DN30; Q86YP8; Q8TAT9;
Q9H3R3;
13-DEC-2001, integrated into UniProtKB/Swiss-Prot.
01-MAY-2000, sequence version 1.
27-SEP-2017, entry version 172.
RecName: Full=Appetite-regulating hormone;
AltName: Full=Growth hormone secretagogue;
AltName: Full=Growth hormone-releasing peptide;
AltName: Full=Motilin-related peptide;
AltName: Full=Protein M46;
Contains:
RecName: Full=Ghrelin-27;
Contains:
RecName: Full=Ghrelin-28;
Short=Ghrelin;
Contains:
RecName: Full=Obestatin;
Flags: Precursor;
Name=GHRL; Synonyms=MTLRP; ORFNames=UNQ524/PRO1066;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND ACYLATION AT SER-26.
TISSUE=Stomach;
PubMed=10604470; DOI=10.1038/45230;
Kojima M., Hosoda H., Date Y., Nakazato M., Matsuo H., Kangawa K.;
"Ghrelin is a growth-hormone-releasing acylated peptide from
stomach.";
Nature 402:656-660(1999).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND PROTEIN SEQUENCE OF 24-33.
TISSUE=Stomach;
PubMed=10930375; DOI=10.1053/gast.2000.9371;
Tomasetto C., Karam S.M., Ribieras S., Masson R., Lefebvre O.,
Staub A., Alexander G., Chenard M.-P., Rio M.-C.;
"Identification and characterization of a novel gastric peptide
hormone: the motilin-related peptide.";
Gastroenterology 119:395-405(2000).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Wajnrajch M.P., Ten I.S., Gertner J.M., Leibel R.L.;
"Genomic organization of the human Ghrelin gene.";
J. Endocr. Genet. 1:231-233(2000).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, ACYLATION
AT SER-26, AND MASS SPECTROMETRY.
TISSUE=Stomach;
PubMed=12414809; DOI=10.1074/jbc.M205366200;
Hosoda H., Kojima M., Mizushima T., Shimizu S., Kangawa K.;
"Structural divergence of human ghrelin. Identification of multiple
ghrelin-derived molecules produced by post-translational processing.";
J. Biol. Chem. 278:64-70(2003).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
TISSUE=Heart, Kidney, Placenta, and Stomach;
PubMed=17727735; DOI=10.1186/1471-2164-8-298;
Seim I., Collet C., Herington A.C., Chopin L.K.;
"Revised genomic structure of the human ghrelin gene and
identification of novel exons, alternative splice variants and natural
antisense transcripts.";
BMC Genomics 8:298-298(2007).
[6]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
Jeffery P.L., Herington A.C., Chopin L.K.;
"Identification and expression pattern of an exon 3-deleted proghrelin
variant in the prostate.";
Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16641997; DOI=10.1038/nature04728;
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R.,
Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R.,
Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V.,
Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.,
Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B.,
Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S.,
Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q.,
Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z.,
Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C.,
Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G.,
Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B.,
Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R.,
Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J.,
Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A.,
Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B.,
Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H.,
Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J.,
Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J.,
Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H.,
Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G.,
Gibbs R.A.;
"The DNA sequence, annotation and analysis of human chromosome 3.";
Nature 440:1194-1198(2006).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
MET-72.
TISSUE=Blood;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[11]
PROTEIN SEQUENCE OF 24-38.
PubMed=15340161; DOI=10.1110/ps.04682504;
Zhang Z., Henzel W.J.;
"Signal peptide prediction based on analysis of experimentally
verified cleavage sites.";
Protein Sci. 13:2819-2824(2004).
[12]
REVIEW.
PubMed=11306336; DOI=10.1016/S1043-2760(00)00362-3;
Kojima M., Hosoda H., Matsuo H., Kangawa K.;
"Ghrelin: discovery of the natural endogenous ligand for the growth
hormone secretagogue receptor.";
Trends Endocrinol. Metab. 12:118-122(2001).
-!- FUNCTION: Ghrelin is the ligand for growth hormone secretagogue
receptor type 1 (GHSR). Induces the release of growth hormone from
the pituitary. Has an appetite-stimulating effect, induces
adiposity and stimulates gastric acid secretion. Involved in
growth regulation.
-!- FUNCTION: Obestatin may be the ligand for GPR39. May have an
appetite-reducing effect resulting in decreased food intake. May
reduce gastric emptying activity and jejunal motility (By
similarity). {ECO:0000250}.
-!- INTERACTION:
Q9UMX0:UBQLN1; NbExp=3; IntAct=EBI-10319458, EBI-741480;
Q9UMX0-2:UBQLN1; NbExp=3; IntAct=EBI-10319458, EBI-10173939;
-!- SUBCELLULAR LOCATION: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=1; Synonyms=Ghrelin;
IsoId=Q9UBU3-1; Sequence=Displayed;
Name=2; Synonyms=des-Gln14-ghrelin;
IsoId=Q9UBU3-2; Sequence=VSP_003245;
Name=3;
IsoId=Q9UBU3-3; Sequence=VSP_041437;
Name=4;
IsoId=Q9UBU3-4; Sequence=VSP_041437, VSP_003245;
Name=5;
IsoId=Q9UBU3-5; Sequence=VSP_041438;
Name=6;
IsoId=Q9UBU3-6; Sequence=VSP_047642;
-!- TISSUE SPECIFICITY: Highest level in stomach. All forms are found
in serum as well. Other tissues compensate for the loss of ghrelin
synthesis in the stomach following gastrectomy.
{ECO:0000269|PubMed:12414809}.
-!- PTM: O-octanoylation or O-decanoylation is essential for ghrelin
activity. The O-decanoylated forms Ghrelin-27-C10 and Ghrelin-28-
C10 differ in the length of the carbon backbone of the carboxylic
acid bound to Ser-26. A small fraction of ghrelin, ghrelin-28-
C10:1, may be modified with a singly unsaturated carboxylic acid
(PubMed:10604470). {ECO:0000269|PubMed:10604470}.
-!- PTM: Amidation of Leu-98 is essential for obestatin activity.
{ECO:0000250}.
-!- MASS SPECTROMETRY: Mass=3398.9; Mass_error=0.3;
Method=Electrospray; Range=24-51; Note=Ghrelin-28-C10, O-
decanoylated form.; Evidence={ECO:0000269|PubMed:12414809};
-!- MASS SPECTROMETRY: Mass=3397.2; Mass_error=0.5;
Method=Electrospray; Range=24-51; Note=Ghrelin-28-C10:1, O-
decenoylated form.; Evidence={ECO:0000269|PubMed:12414809};
-!- MASS SPECTROMETRY: Mass=3371.3; Mass_error=0.1;
Method=Electrospray; Range=24-51; Note=Ghrelin-28-C8, O-
octanoylated form.; Evidence={ECO:0000269|PubMed:12414809};
-!- MASS SPECTROMETRY: Mass=3243.6; Mass_error=0.4;
Method=Electrospray; Range=24-50; Note=Ghrelin-27-C10, O-
decanoylated form.; Evidence={ECO:0000269|PubMed:12414809};
-!- MASS SPECTROMETRY: Mass=3214.6; Mass_error=0.6;
Method=Electrospray; Range=24-50; Note=Ghrelin-27-C8, O-
octanoylated form.; Evidence={ECO:0000269|PubMed:12414809};
-!- SIMILARITY: Belongs to the motilin family. {ECO:0000305}.
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
URL="http://atlasgeneticsoncology.org/Genes/GhrelinID327.html";
-!- WEB RESOURCE: Name=Protein Spotlight; Note=Gut feelings - Issue 66
of January 2006;
URL="http://web.expasy.org/spotlight/back_issues/066";
-!- WEB RESOURCE: Name=Wikipedia; Note=Ghrelin entry;
URL="https://en.wikipedia.org/wiki/Ghrelin";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AB029434; BAA89371.1; -; mRNA.
EMBL; AJ252278; CAB65733.1; -; mRNA.
EMBL; AF296558; AAG10300.1; -; Genomic_DNA.
EMBL; EU072086; ABV55189.1; -; mRNA.
EMBL; EF549569; ABQ40357.1; -; mRNA.
EMBL; EF549571; ABQ40358.1; -; mRNA.
EMBL; EF549572; ABQ40359.1; -; mRNA.
EMBL; EF549573; ABQ40360.1; -; mRNA.
EMBL; EF549574; ABQ40361.1; -; mRNA.
EMBL; EF549575; ABQ40362.1; -; mRNA.
EMBL; EU072083; ABV55186.1; -; mRNA.
EMBL; EU072084; ABV55187.1; -; mRNA.
EMBL; EU072085; ABV55188.1; -; mRNA.
EMBL; EU072087; ABV55190.1; -; mRNA.
EMBL; AY184207; AAO27351.1; -; mRNA.
EMBL; AY359053; AAQ89412.1; -; mRNA.
EMBL; AC022384; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471055; EAW64074.1; -; Genomic_DNA.
EMBL; CH471055; EAW64075.1; -; Genomic_DNA.
EMBL; BC025791; AAH25791.1; -; mRNA.
EMBL; AB035700; BAB19045.1; -; mRNA.
CCDS; CCDS33700.1; -. [Q9UBU3-1]
CCDS; CCDS46747.1; -. [Q9UBU3-5]
CCDS; CCDS46748.1; -. [Q9UBU3-3]
CCDS; CCDS46749.1; -. [Q9UBU3-4]
CCDS; CCDS46750.1; -. [Q9UBU3-2]
PIR; A59316; A59316.
RefSeq; NP_001128413.1; NM_001134941.2. [Q9UBU3-2]
RefSeq; NP_001128416.1; NM_001134944.1. [Q9UBU3-3]
RefSeq; NP_001128417.1; NM_001134945.1. [Q9UBU3-4]
RefSeq; NP_001128418.1; NM_001134946.1. [Q9UBU3-5]
RefSeq; NP_001289750.1; NM_001302821.1. [Q9UBU3-1]
RefSeq; NP_001289751.1; NM_001302822.1. [Q9UBU3-1]
RefSeq; NP_001289752.1; NM_001302823.1. [Q9UBU3-2]
RefSeq; NP_001289753.1; NM_001302824.1. [Q9UBU3-1]
RefSeq; NP_001289754.1; NM_001302825.1. [Q9UBU3-1]
RefSeq; NP_057446.1; NM_016362.4. [Q9UBU3-1]
RefSeq; XP_016862101.1; XM_017006612.1. [Q9UBU3-1]
RefSeq; XP_016862102.1; XM_017006613.1. [Q9UBU3-2]
UniGene; Hs.590080; -.
UniGene; Hs.672979; -.
PDB; 1P7X; Model; -; A=1-117.
PDBsum; 1P7X; -.
ProteinModelPortal; Q9UBU3; -.
BioGrid; 119706; 5.
IntAct; Q9UBU3; 2.
STRING; 9606.ENSP00000335074; -.
BindingDB; Q9UBU3; -.
ChEMBL; CHEMBL1921664; -.
iPTMnet; Q9UBU3; -.
PhosphoSitePlus; Q9UBU3; -.
BioMuta; GHRL; -.
DMDM; 17865471; -.
PaxDb; Q9UBU3; -.
PeptideAtlas; Q9UBU3; -.
PRIDE; Q9UBU3; -.
DNASU; 51738; -.
Ensembl; ENST00000287656; ENSP00000287656; ENSG00000157017. [Q9UBU3-2]
Ensembl; ENST00000335542; ENSP00000335074; ENSG00000157017. [Q9UBU3-1]
Ensembl; ENST00000422159; ENSP00000405464; ENSG00000157017. [Q9UBU3-6]
Ensembl; ENST00000429122; ENSP00000414819; ENSG00000157017. [Q9UBU3-1]
Ensembl; ENST00000430179; ENSP00000399922; ENSG00000157017. [Q9UBU3-2]
Ensembl; ENST00000437422; ENSP00000416768; ENSG00000157017. [Q9UBU3-3]
Ensembl; ENST00000439975; ENSP00000403725; ENSG00000157017. [Q9UBU3-5]
Ensembl; ENST00000449238; ENSP00000388145; ENSG00000157017. [Q9UBU3-4]
Ensembl; ENST00000457360; ENSP00000391406; ENSG00000157017. [Q9UBU3-1]
GeneID; 51738; -.
KEGG; hsa:51738; -.
UCSC; uc003bvj.2; human. [Q9UBU3-1]
CTD; 51738; -.
DisGeNET; 51738; -.
EuPathDB; HostDB:ENSG00000157017.15; -.
GeneCards; GHRL; -.
HGNC; HGNC:18129; GHRL.
HPA; CAB022731; -.
HPA; HPA014246; -.
MalaCards; GHRL; -.
MIM; 605353; gene.
neXtProt; NX_Q9UBU3; -.
OpenTargets; ENSG00000157017; -.
PharmGKB; PA142671740; -.
eggNOG; ENOG410IZYV; Eukaryota.
eggNOG; ENOG410ZG1B; LUCA.
GeneTree; ENSGT00390000004064; -.
HOGENOM; HOG000146466; -.
HOVERGEN; HBG018522; -.
InParanoid; Q9UBU3; -.
KO; K05254; -.
OMA; EIQFNAP; -.
OrthoDB; EOG091G0YG0; -.
PhylomeDB; Q9UBU3; -.
TreeFam; TF336219; -.
Reactome; R-HSA-375276; Peptide ligand-binding receptors.
Reactome; R-HSA-416476; G alpha (q) signalling events.
Reactome; R-HSA-422085; Synthesis, secretion, and deacylation of Ghrelin.
SIGNOR; Q9UBU3; -.
GeneWiki; Ghrelin; -.
GenomeRNAi; 51738; -.
PMAP-CutDB; Q9UBU3; -.
PRO; PR:Q9UBU3; -.
Proteomes; UP000005640; Chromosome 3.
Bgee; ENSG00000157017; -.
CleanEx; HS_GHRL; -.
ExpressionAtlas; Q9UBU3; baseline and differential.
Genevisible; Q9UBU3; HS.
GO; GO:0030424; C:axon; IDA:UniProtKB.
GO; GO:0005788; C:endoplasmic reticulum lumen; TAS:Reactome.
GO; GO:0005576; C:extracellular region; IDA:UniProtKB.
GO; GO:0005615; C:extracellular space; IDA:UniProtKB.
GO; GO:0098794; C:postsynapse; IEA:GOC.
GO; GO:0034774; C:secretory granule lumen; TAS:Reactome.
GO; GO:0001664; F:G-protein coupled receptor binding; ISS:UniProtKB.
GO; GO:0031768; F:ghrelin receptor binding; ISS:UniProtKB.
GO; GO:0016608; F:growth hormone-releasing hormone activity; ISS:UniProtKB.
GO; GO:0030296; F:protein tyrosine kinase activator activity; IMP:UniProtKB.
GO; GO:0008154; P:actin polymerization or depolymerization; IDA:UniProtKB.
GO; GO:0000187; P:activation of MAPK activity; IMP:UniProtKB.
GO; GO:0008343; P:adult feeding behavior; ISS:HGNC.
GO; GO:0051216; P:cartilage development; NAS:UniProtKB.
GO; GO:0043400; P:cortisol secretion; NAS:UniProtKB.
GO; GO:0046697; P:decidualization; IDA:UniProtKB.
GO; GO:0016358; P:dendrite development; IDA:MGI.
GO; GO:0060079; P:excitatory postsynaptic potential; IEA:Ensembl.
GO; GO:0007186; P:G-protein coupled receptor signaling pathway; ISS:UniProtKB.
GO; GO:0001696; P:gastric acid secretion; IBA:GO_Central.
GO; GO:0035483; P:gastric emptying; IEA:Ensembl.
GO; GO:0006006; P:glucose metabolic process; NAS:UniProtKB.
GO; GO:0030252; P:growth hormone secretion; TAS:HGNC.
GO; GO:0009755; P:hormone-mediated signaling pathway; TAS:HGNC.
GO; GO:0016525; P:negative regulation of angiogenesis; NAS:UniProtKB.
GO; GO:0043066; P:negative regulation of apoptotic process; IDA:UniProtKB.
GO; GO:0042322; P:negative regulation of circadian sleep/wake cycle, REM sleep; IDA:BHF-UCL.
GO; GO:0001937; P:negative regulation of endothelial cell proliferation; IDA:UniProtKB.
GO; GO:2000506; P:negative regulation of energy homeostasis; IEA:Ensembl.
GO; GO:0050728; P:negative regulation of inflammatory response; IDA:UniProtKB.
GO; GO:0046676; P:negative regulation of insulin secretion; IEA:Ensembl.
GO; GO:0032691; P:negative regulation of interleukin-1 beta production; IDA:UniProtKB.
GO; GO:0045409; P:negative regulation of interleukin-6 biosynthetic process; IDA:UniProtKB.
GO; GO:0040013; P:negative regulation of locomotion; IEA:Ensembl.
GO; GO:0042536; P:negative regulation of tumor necrosis factor biosynthetic process; IDA:UniProtKB.
GO; GO:1904468; P:negative regulation of tumor necrosis factor secretion; IEA:Ensembl.
GO; GO:1904179; P:positive regulation of adipose tissue development; IEA:Ensembl.
GO; GO:0032100; P:positive regulation of appetite; ISS:HGNC.
GO; GO:1903012; P:positive regulation of bone development; IEA:Ensembl.
GO; GO:0046010; P:positive regulation of circadian sleep/wake cycle, non-REM sleep; IDA:BHF-UCL.
GO; GO:0051461; P:positive regulation of corticotropin secretion; IDA:BHF-UCL.
GO; GO:0051464; P:positive regulation of cortisol secretion; IDA:BHF-UCL.
GO; GO:0007204; P:positive regulation of cytosolic calcium ion concentration; ISS:UniProtKB.
GO; GO:1904000; P:positive regulation of eating behavior; IEA:Ensembl.
GO; GO:2000507; P:positive regulation of energy homeostasis; IEA:Ensembl.
GO; GO:1904346; P:positive regulation of gastric mucosal blood circulation; IEA:Ensembl.
GO; GO:0060399; P:positive regulation of growth hormone receptor signaling pathway; IC:BHF-UCL.
GO; GO:0060124; P:positive regulation of growth hormone secretion; IDA:BHF-UCL.
GO; GO:0040010; P:positive regulation of growth rate; IEA:Ensembl.
GO; GO:0032024; P:positive regulation of insulin secretion; ISS:UniProtKB.
GO; GO:0035774; P:positive regulation of insulin secretion involved in cellular response to glucose stimulus; IEA:Ensembl.
GO; GO:0040018; P:positive regulation of multicellular organism growth; IC:HGNC.
GO; GO:0120058; P:positive regulation of small intestinal transit; IEA:Ensembl.
GO; GO:1904349; P:positive regulation of small intestine smooth muscle contraction; IEA:Ensembl.
GO; GO:1903672; P:positive regulation of sprouting angiogenesis; IEA:Ensembl.
GO; GO:0051965; P:positive regulation of synapse assembly; IDA:MGI.
GO; GO:1905564; P:positive regulation of vascular endothelial cell proliferation; IEA:Ensembl.
GO; GO:0042127; P:regulation of cell proliferation; IDA:UniProtKB.
GO; GO:1905333; P:regulation of gastric motility; IEA:Ensembl.
GO; GO:0032095; P:regulation of response to food; IBA:GO_Central.
GO; GO:0051969; P:regulation of transmission of nerve impulse; IEA:Ensembl.
GO; GO:0051602; P:response to electrical stimulus; IEA:Ensembl.
GO; GO:0043627; P:response to estrogen; IDA:UniProtKB.
GO; GO:0009725; P:response to hormone; IDA:UniProtKB.
InterPro; IPR006737; Motilin_assoc.
InterPro; IPR006738; Motilin_ghrelin.
InterPro; IPR005441; Preproghrelin.
PANTHER; PTHR14122; PTHR14122; 1.
Pfam; PF04643; Motilin_assoc; 1.
Pfam; PF04644; Motilin_ghrelin; 1.
PRINTS; PR01624; GHRELIN.
1: Evidence at protein level;
3D-structure; Alternative splicing; Amidation; Complete proteome;
Direct protein sequencing; Hormone; Lipoprotein; Polymorphism;
Reference proteome; Secreted; Signal.
SIGNAL 1 23 {ECO:0000269|PubMed:10930375,
ECO:0000269|PubMed:15340161}.
PEPTIDE 24 51 Ghrelin-28.
/FTId=PRO_0000019202.
PEPTIDE 24 50 Ghrelin-27.
/FTId=PRO_0000019203.
PROPEP 52 75 Removed in mature form.
/FTId=PRO_0000019204.
PEPTIDE 76 98 Obestatin. {ECO:0000250}.
/FTId=PRO_0000045140.
PROPEP 99 117 Removed in mature form. {ECO:0000250}.
/FTId=PRO_0000045141.
MOD_RES 98 98 Leucine amide. {ECO:0000250}.
LIPID 26 26 O-decanoyl serine; alternate.
{ECO:0000269|PubMed:10604470,
ECO:0000269|PubMed:12414809}.
LIPID 26 26 O-octanoyl serine; alternate.
{ECO:0000269|PubMed:10604470,
ECO:0000269|PubMed:12414809}.
VAR_SEQ 1 75 MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKES
KKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVR -> MFT
CWWSYLRSTLAAVPGEASRVQ (in isoform 5).
{ECO:0000303|PubMed:17727735}.
/FTId=VSP_041438.
VAR_SEQ 1 36 MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQ -> M
FTCWWSYLRSTLAAVPGEASRVQ (in isoform 3 and
isoform 4).
{ECO:0000303|PubMed:17727735}.
/FTId=VSP_041437.
VAR_SEQ 37 37 Missing (in isoform 2 and isoform 4).
{ECO:0000303|PubMed:12414809,
ECO:0000303|PubMed:17727735}.
/FTId=VSP_003245.
VAR_SEQ 76 117 FNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPAD
K -> RPQPTSDRPQALLTSL (in isoform 6).
{ECO:0000303|Ref.6}.
/FTId=VSP_047642.
VARIANT 72 72 L -> M (in dbSNP:rs696217).
{ECO:0000269|PubMed:15489334}.
/FTId=VAR_050095.
VARIANT 90 90 Q -> L (in dbSNP:rs4684677).
/FTId=VAR_029135.
SEQUENCE 117 AA; 12911 MW; 39C0572EBECA2755 CRC64;
MPSPGTVCSL LLLGMLWLDL AMAGSSFLSP EHQRVQQRKE SKKPPAKLQP RALAGWLRPE
DGGQAEGAED ELEVRFNAPF DVGIKLSGVQ YQQHSQALGK FLQDILWEEA KEAPADK


Related products :

Catalog number Product name Quantity
20-272-190992 Ghrelin - Mouse monoclonal [Ghr6] to Ghrelin; Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein Monoclonal 0.05 mg
20-272-190990 Ghrelin - Mouse monoclonal [Ghr2] to Ghrelin; Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein Monoclonal 0.05 mg
20-272-190991 Ghrelin - Mouse monoclonal [Ghr5] to Ghrelin; Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein Monoclonal 0.05 mg
18-272-196206 Ghrelin - Rabbit polyclonal to Ghrelin; Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein Polyclonal 0.5 ml
18-272-196205 Ghrelin - Rabbit polyclonal to Ghrelin; Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein Polyclonal 0.5 ml
U2142m CLIA Appetite-regulating hormone,Ghrl,Growth hormone secretagogue,Growth hormone-releasing peptide,Motilin-related peptide,Mouse,Mtlrp,Mus musculus,Protein M46 96T
E2142m ELISA Appetite-regulating hormone,Ghrl,Growth hormone secretagogue,Growth hormone-releasing peptide,Motilin-related peptide,Mouse,Mtlrp,Mus musculus,Protein M46 96T
E2142m ELISA kit Appetite-regulating hormone,Ghrl,Growth hormone secretagogue,Growth hormone-releasing peptide,Motilin-related peptide,Mouse,Mtlrp,Mus musculus,Protein M46 96T
U2142m CLIA kit Appetite-regulating hormone,Ghrl,Growth hormone secretagogue,Growth hormone-releasing peptide,Motilin-related peptide,Mouse,Mtlrp,Mus musculus,Protein M46 96T
18-783-77210 RABBIT ANTI HUMAN GHRELIN - Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein Polyclonal 1 ml
10-783-79455 SYNTHETIC HUMAN GHRELIN - Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein 0.05 mg
E2142h ELISA Appetite-regulating hormone,GHRL,Growth hormone secretagogue,Growth hormone-releasing peptide,Homo sapiens,Human,Motilin-related peptide,MTLRP,Protein M46,UNQ524_PRO1066 96T
U2142h CLIA Appetite-regulating hormone,GHRL,Growth hormone secretagogue,Growth hormone-releasing peptide,Homo sapiens,Human,Motilin-related peptide,MTLRP,Protein M46,UNQ524_PRO1066 96T
U2142h CLIA kit Appetite-regulating hormone,GHRL,Growth hormone secretagogue,Growth hormone-releasing peptide,Homo sapiens,Human,Motilin-related peptide,MTLRP,Protein M46,UNQ524_PRO1066 96T
E2142h ELISA kit Appetite-regulating hormone,GHRL,Growth hormone secretagogue,Growth hormone-releasing peptide,Homo sapiens,Human,Motilin-related peptide,MTLRP,Protein M46,UNQ524_PRO1066 96T
15-288-22774 Appetite-regulating hormone - Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein Polyclonal 0.05 mg
15-288-22773 Appetite-regulating hormone - Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein Polyclonal 0.1 mg
15-288-22773 Appetite-regulating hormone - Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein Polyclonal 0.05 mg
15-288-22774 Appetite-regulating hormone - Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; M46 protein Polyclonal 0.1 mg
E2142b ELISA kit Appetite-regulating hormone,Bos taurus,Bovine,GHRL,Growth hormone secretagogue,Growth hormone-releasing peptide,Motilin-related peptide 96T
U2142r CLIA kit Appetite-regulating hormone,Ghrl,Growth hormone secretagogue,Growth hormone-releasing peptide,Motilin-related peptide,Rat,Rattus norvegicus 96T
U2142b CLIA kit Appetite-regulating hormone,Bos taurus,Bovine,GHRL,Growth hormone secretagogue,Growth hormone-releasing peptide,Motilin-related peptide 96T
E2142r ELISA Appetite-regulating hormone,Ghrl,Growth hormone secretagogue,Growth hormone-releasing peptide,Motilin-related peptide,Rat,Rattus norvegicus 96T
E2142r ELISA kit Appetite-regulating hormone,Ghrl,Growth hormone secretagogue,Growth hormone-releasing peptide,Motilin-related peptide,Rat,Rattus norvegicus 96T
E2142b ELISA Appetite-regulating hormone,Bos taurus,Bovine,GHRL,Growth hormone secretagogue,Growth hormone-releasing peptide,Motilin-related peptide 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur