Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

BDNF/NT-3 growth factors receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 2) (TrkB tyrosine kinase) (Trk-B)

 NTRK2_CHICK             Reviewed;         818 AA.
Q91987; Q91010;
15-JUL-1998, integrated into UniProtKB/Swiss-Prot.
01-NOV-1996, sequence version 1.
25-OCT-2017, entry version 162.
RecName: Full=BDNF/NT-3 growth factors receptor;
EC=2.7.10.1;
AltName: Full=Neurotrophic tyrosine kinase receptor type 2;
AltName: Full=TrkB tyrosine kinase;
Short=Trk-B;
Flags: Precursor;
Name=NTRK2; Synonyms=TRKB;
Gallus gallus (Chicken).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
Phasianidae; Phasianinae; Gallus.
NCBI_TaxID=9031;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 10).
TISSUE=Brain;
PubMed=7959025; DOI=10.1016/0378-1119(94)90184-8;
Vinh N., Erdmann K., Heumann R.;
"Cloning and sequence analysis of a cDNA encoding a novel truncated
form of the chicken TrkB receptor.";
Gene 149:383-384(1994).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=8287802;
Dechant G., Biffo S., Okazawa H., Kolbeck R., Pottgiesser J.,
Barde Y.-A.;
"Expression and binding characteristics of the BDNF receptor chick
trkB.";
Development 119:545-558(1993).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND PARTIAL NUCLEOTIDE
SEQUENCE (ISOFORMS 2; 3; 4; 5; 6; 7; 8; 9; 10; 11 AND 12).
PubMed=8774442;
Garner A.S., Menegay H.J., Boeshore K.L., Xie X.Y., Voci J.M.,
Johnson J.E., Large T.H.;
"Expression of TrkB receptor isoforms in the developing avian visual
system.";
J. Neurosci. 16:1740-1752(1996).
[4]
ALTERNATIVE SPLICING (ISOFORMS 1 AND 9), AND LIGAND-BINDING.
PubMed=8670834;
Strohmaier C., Carter B.D., Urfer R., Barde Y.A., Dechant G.;
"A splice variant of the neurotrophin receptor trkB with increased
specificity for brain-derived neurotrophic factor.";
EMBO J. 15:3332-3337(1996).
-!- FUNCTION: Receptor tyrosine kinase involved in the development and
the maturation of the central and the peripheral nervous systems
through regulation of neuron survival, proliferation, migration,
differentiation, and synapse formation and plasticity. Receptor
for BDNF/brain-derived neurotrophic factor and NTF4/neurotrophin-
4. Alternatively can also bind NTF3/neurotrophin-3 which is less
efficient in activating the receptor but regulates neuron survival
through NTRK2. Upon ligand-binding, undergoes homodimerization,
autophosphorylation and activation. Recruits, phosphorylates
and/or activates several downstream effectors that regulate
distinct overlapping signaling cascades. Activates the GRB2-Ras-
MAPK cascade that regulates for instance neuronal differentiation
including neurite outgrowth. Controls the Ras-PI3 kinase-AKT1
signaling cascade that mainly regulates growth and survival.
Through the downstream protein kinase C-regulated pathways
controls synaptic plasticity. Thereby, plays a role in learning
and memory by regulating both short term synaptic function and
long-term potentiation. Also regulates the transcription of genes
involved in cell survival. Hence, it is able to suppress anoikis,
the apoptosis resulting from loss of cell-matrix interactions. May
also play a role in neutrophin-dependent calcium signaling in
glial cells.
-!- CATALYTIC ACTIVITY: ATP + a [protein]-L-tyrosine = ADP + a
[protein]-L-tyrosine phosphate. {ECO:0000255|PROSITE-
ProRule:PRU10028}.
-!- ENZYME REGULATION: The neuronal activity and the influx of calcium
positively regulate the kinase activity and the internalization of
the receptor which are both important for active signaling.
Regulated by NGFR that may control the internalization of the
receptor. NGFR may also stimulate the activation by BDNF compared
to NTF3 and NTF4. The formation of active receptors dimers able to
fully transduce the ligand-mediated signal, may be negatively
regulated by the formation of inactive heterodimers with the non-
catalytic isoforms (By similarity). {ECO:0000250}.
-!- SUBUNIT: Exists in a dynamic equilibrium between monomeric (low
affinity) and dimeric (high affinity) structures (By similarity).
Interacts with NGFR; may regulate the ligand specificity of the
receptor. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane
protein. Endosome membrane {ECO:0000250}; Single-pass type I
membrane protein {ECO:0000250}. Note=Internalized to endosomes
upon ligand-binding. {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=12;
Comment=Additional isoforms seem to exist.;
Name=1; Synonyms=Alpha-FL, cTrkB-L;
IsoId=Q91987-1; Sequence=Displayed;
Name=2; Synonyms=Beta-FL;
IsoId=Q91987-2; Sequence=VSP_002914;
Note=It is unsure whether Leu-144 or Met-188 is the initiator of
isoform 2.;
Name=3; Synonyms=ED;
IsoId=Q91987-3; Sequence=VSP_002915;
Name=4; Synonyms=JD;
IsoId=Q91987-4; Sequence=VSP_002923;
Name=5; Synonyms=J1;
IsoId=Q91987-5; Sequence=VSP_002920;
Name=6; Synonyms=Alpha-T1;
IsoId=Q91987-6; Sequence=VSP_002918, VSP_002919;
Name=7; Synonyms=J1+T1;
IsoId=Q91987-7; Sequence=VSP_002920, VSP_002918, VSP_002919;
Name=8; Synonyms=J2+T1;
IsoId=Q91987-8; Sequence=VSP_002921, VSP_002918, VSP_002919;
Name=9; Synonyms=ED J2+T1, cTrkB-S;
IsoId=Q91987-9; Sequence=VSP_002915, VSP_002921, VSP_002918,
VSP_002919;
Note=Specifically activated by BDNF but not NTF3 and NTF4.;
Name=10; Synonyms=J1+J2+T1;
IsoId=Q91987-10; Sequence=VSP_002922, VSP_002918, VSP_002919;
Name=11; Synonyms=T3;
IsoId=Q91987-11; Sequence=VSP_002916, VSP_002917;
Name=12; Synonyms=ED J1+J2+T1;
IsoId=Q91987-12; Sequence=VSP_002915, VSP_002922, VSP_002918,
VSP_002919;
-!- PTM: Ligand-mediated auto-phosphorylation.
-!- SIMILARITY: Belongs to the protein kinase superfamily. Tyr protein
kinase family. Insulin receptor subfamily. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X77251; CAA54468.1; -; mRNA.
EMBL; X77252; CAA54469.1; -; mRNA.
EMBL; X74109; CAA52210.1; -; mRNA.
PIR; S59938; S44099.
PIR; S59939; S44098.
RefSeq; NP_990562.1; NM_205231.1. [Q91987-1]
RefSeq; XP_015135735.1; XM_015280249.1. [Q91987-5]
RefSeq; XP_015135738.1; XM_015280252.1. [Q91987-3]
RefSeq; XP_015135740.1; XM_015280254.1. [Q91987-10]
RefSeq; XP_015135741.1; XM_015280255.1. [Q91987-7]
RefSeq; XP_015135742.1; XM_015280256.1. [Q91987-8]
RefSeq; XP_015135743.1; XM_015280257.1. [Q91987-6]
UniGene; Gga.681; -.
ProteinModelPortal; Q91987; -.
SMR; Q91987; -.
STRING; 9031.ENSGALP00000020539; -.
PaxDb; Q91987; -.
Ensembl; ENSGALT00000020568; ENSGALP00000020539; ENSGALG00000012594. [Q91987-1]
Ensembl; ENSGALT00000086171; ENSGALP00000062213; ENSGALG00000012594. [Q91987-10]
GeneID; 396157; -.
KEGG; gga:396157; -.
CTD; 4915; -.
eggNOG; KOG1026; Eukaryota.
eggNOG; ENOG410YGKQ; LUCA.
GeneTree; ENSGT00760000118818; -.
HOGENOM; HOG000264255; -.
HOVERGEN; HBG056735; -.
InParanoid; Q91987; -.
KO; K04360; -.
OMA; CSCEIMW; -.
OrthoDB; EOG091G01JY; -.
PhylomeDB; Q91987; -.
BRENDA; 2.7.10.1; 1306.
PRO; PR:Q91987; -.
Proteomes; UP000000539; Chromosome Z.
Bgee; ENSGALG00000012594; -.
GO; GO:0005829; C:cytosol; IEA:Ensembl.
GO; GO:0005769; C:early endosome; IEA:Ensembl.
GO; GO:0010008; C:endosome membrane; IEA:UniProtKB-SubCell.
GO; GO:0005887; C:integral component of plasma membrane; ISS:UniProtKB.
GO; GO:0014069; C:postsynaptic density; IEA:Ensembl.
GO; GO:0045211; C:postsynaptic membrane; IEA:Ensembl.
GO; GO:0043235; C:receptor complex; IEA:Ensembl.
GO; GO:0043195; C:terminal bouton; IEA:Ensembl.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0048403; F:brain-derived neurotrophic factor binding; ISS:UniProtKB.
GO; GO:0060175; F:brain-derived neurotrophic factor-activated receptor activity; ISS:UniProtKB.
GO; GO:0005004; F:GPI-linked ephrin receptor activity; IDA:BHF-UCL.
GO; GO:0043121; F:neurotrophin binding; ISS:UniProtKB.
GO; GO:0042803; F:protein homodimerization activity; ISS:UniProtKB.
GO; GO:0005244; F:voltage-gated ion channel activity; IDA:AgBase.
GO; GO:0031547; P:brain-derived neurotrophic factor receptor signaling pathway; ISS:UniProtKB.
GO; GO:0071230; P:cellular response to amino acid stimulus; IEA:Ensembl.
GO; GO:0021954; P:central nervous system neuron development; ISS:UniProtKB.
GO; GO:0021987; P:cerebral cortex development; ISS:UniProtKB.
GO; GO:0007623; P:circadian rhythm; IEA:Ensembl.
GO; GO:0048668; P:collateral sprouting; IMP:BHF-UCL.
GO; GO:0007631; P:feeding behavior; IEA:Ensembl.
GO; GO:0014047; P:glutamate secretion; IEA:Ensembl.
GO; GO:0007612; P:learning; ISS:UniProtKB.
GO; GO:0060291; P:long-term synaptic potentiation; IEA:Ensembl.
GO; GO:0042490; P:mechanoreceptor differentiation; IEA:Ensembl.
GO; GO:2000811; P:negative regulation of anoikis; IEA:Ensembl.
GO; GO:0043524; P:negative regulation of neuron apoptotic process; ISS:UniProtKB.
GO; GO:0007528; P:neuromuscular junction development; IEA:Ensembl.
GO; GO:0030182; P:neuron differentiation; ISS:UniProtKB.
GO; GO:0001764; P:neuron migration; ISS:UniProtKB.
GO; GO:0048709; P:oligodendrocyte differentiation; IEA:Ensembl.
GO; GO:0048935; P:peripheral nervous system neuron development; IEA:Ensembl.
GO; GO:0050772; P:positive regulation of axonogenesis; ISS:UniProtKB.
GO; GO:0008284; P:positive regulation of cell proliferation; ISS:UniProtKB.
GO; GO:0048672; P:positive regulation of collateral sprouting; IMP:BHF-UCL.
GO; GO:0010628; P:positive regulation of gene expression; ISS:UniProtKB.
GO; GO:0043410; P:positive regulation of MAPK cascade; ISS:UniProtKB.
GO; GO:0010976; P:positive regulation of neuron projection development; ISS:UniProtKB.
GO; GO:0033138; P:positive regulation of peptidyl-serine phosphorylation; IEA:Ensembl.
GO; GO:0014068; P:positive regulation of phosphatidylinositol 3-kinase signaling; ISS:UniProtKB.
GO; GO:0051965; P:positive regulation of synapse assembly; IEA:Ensembl.
GO; GO:0046777; P:protein autophosphorylation; ISS:UniProtKB.
GO; GO:1903859; P:regulation of dendrite extension; IDA:AgBase.
GO; GO:0043087; P:regulation of GTPase activity; ISS:UniProtKB.
GO; GO:0051896; P:regulation of protein kinase B signaling; IEA:Ensembl.
GO; GO:0060041; P:retina development in camera-type eye; IEA:Ensembl.
GO; GO:0046548; P:retinal rod cell development; IEA:Ensembl.
GO; GO:0099551; P:trans-synaptic signaling by neuropeptide, modulating synaptic transmission; IEA:Ensembl.
GO; GO:0001570; P:vasculogenesis; IEA:Ensembl.
Gene3D; 2.60.40.10; -; 2.
Gene3D; 3.80.10.10; -; 2.
InterPro; IPR000483; Cys-rich_flank_reg_C.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR013098; Ig_I-set.
InterPro; IPR003599; Ig_sub.
InterPro; IPR003598; Ig_sub2.
InterPro; IPR011009; Kinase-like_dom.
InterPro; IPR032675; L_dom-like.
InterPro; IPR001611; Leu-rich_rpt.
InterPro; IPR000372; LRRNT.
InterPro; IPR031635; NTRK_C2.
InterPro; IPR000719; Prot_kinase_dom.
InterPro; IPR017441; Protein_kinase_ATP_BS.
InterPro; IPR001245; Ser-Thr/Tyr_kinase_cat_dom.
InterPro; IPR020455; Tyr_kin_neurotrophic_rcpt_2.
InterPro; IPR008266; Tyr_kinase_AS.
InterPro; IPR020635; Tyr_kinase_cat_dom.
InterPro; IPR020777; Tyr_kinase_NGF_rcpt.
InterPro; IPR002011; Tyr_kinase_rcpt_2_CS.
Pfam; PF07679; I-set; 2.
Pfam; PF13855; LRR_8; 1.
Pfam; PF07714; Pkinase_Tyr; 1.
Pfam; PF16920; TPKR_C2; 1.
PRINTS; PR01939; NTKRECEPTOR.
PRINTS; PR01941; NTKRECEPTOR2.
PRINTS; PR00109; TYRKINASE.
SMART; SM00409; IG; 1.
SMART; SM00408; IGc2; 1.
SMART; SM00082; LRRCT; 1.
SMART; SM00013; LRRNT; 1.
SMART; SM00220; S_TKc; 1.
SMART; SM00219; TyrKc; 1.
SUPFAM; SSF48726; SSF48726; 2.
SUPFAM; SSF52058; SSF52058; 1.
SUPFAM; SSF56112; SSF56112; 1.
PROSITE; PS50835; IG_LIKE; 1.
PROSITE; PS51450; LRR; 1.
PROSITE; PS00107; PROTEIN_KINASE_ATP; 1.
PROSITE; PS50011; PROTEIN_KINASE_DOM; 1.
PROSITE; PS00109; PROTEIN_KINASE_TYR; 1.
PROSITE; PS00239; RECEPTOR_TYR_KIN_II; 1.
1: Evidence at protein level;
Alternative splicing; ATP-binding; Cell membrane; Complete proteome;
Developmental protein; Differentiation; Disulfide bond; Endosome;
Glycoprotein; Immunoglobulin domain; Kinase; Leucine-rich repeat;
Membrane; Neurogenesis; Nucleotide-binding; Phosphoprotein; Receptor;
Reference proteome; Repeat; Signal; Transferase; Transmembrane;
Transmembrane helix; Tyrosine-protein kinase.
SIGNAL 1 31 {ECO:0000250}.
CHAIN 32 818 BDNF/NT-3 growth factors receptor.
/FTId=PRO_0000016730.
TOPO_DOM 32 426 Extracellular. {ECO:0000255}.
TRANSMEM 427 450 Helical. {ECO:0000255}.
TOPO_DOM 451 818 Cytoplasmic. {ECO:0000255}.
REPEAT 71 92 LRR 1.
REPEAT 95 116 LRR 2.
DOMAIN 196 281 Ig-like C2-type 1.
DOMAIN 295 364 Ig-like C2-type 2.
DOMAIN 534 803 Protein kinase. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
NP_BIND 540 548 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
REGION 384 394 Provides specificity for BDNF as ligand
versus NTF3 and NTF4.
ACT_SITE 672 672 Proton acceptor. {ECO:0000255|PROSITE-
ProRule:PRU00159, ECO:0000255|PROSITE-
ProRule:PRU10028}.
BINDING 568 568 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
SITE 512 512 Interaction with SHC1. {ECO:0000250}.
SITE 702 702 Interaction with SH2D1A. {ECO:0000250}.
SITE 813 813 Interaction with PLCG1. {ECO:0000250}.
MOD_RES 512 512 Phosphotyrosine; by autocatalysis.
{ECO:0000250}.
MOD_RES 698 698 Phosphotyrosine; by autocatalysis.
{ECO:0000250}.
MOD_RES 702 702 Phosphotyrosine; by autocatalysis.
{ECO:0000250}.
MOD_RES 703 703 Phosphotyrosine; by autocatalysis.
{ECO:0000250}.
MOD_RES 813 813 Phosphotyrosine; by autocatalysis.
{ECO:0000250}.
CARBOHYD 66 66 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 94 94 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 120 120 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 199 199 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 204 204 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 226 226 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 253 253 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 287 287 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 324 324 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 337 337 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 408 408 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 32 38 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 36 45 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 151 175 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 153 193 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 217 265 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 301 344 {ECO:0000255|PROSITE-ProRule:PRU00114}.
VAR_SEQ 1 187 Missing (in isoform 2). {ECO:0000305}.
/FTId=VSP_002914.
VAR_SEQ 384 394 Missing (in isoform 3, isoform 9 and
isoform 12). {ECO:0000305}.
/FTId=VSP_002915.
VAR_SEQ 462 467 GPSSVI -> ERGRRK (in isoform 11).
{ECO:0000305}.
/FTId=VSP_002916.
VAR_SEQ 462 465 Missing (in isoform 4). {ECO:0000305}.
/FTId=VSP_002923.
VAR_SEQ 462 462 G -> VHGEVKGVGLVDQIWLSLQDCDNEEQVMVTVNSDVH
NNSTASDNNRLG (in isoform 10 and isoform
12). {ECO:0000303|PubMed:7959025}.
/FTId=VSP_002922.
VAR_SEQ 462 462 G -> VHGEVKGVGLVDQIWLSLQDCDNEG (in
isoform 5 and isoform 7). {ECO:0000305}.
/FTId=VSP_002920.
VAR_SEQ 462 462 G -> EQVMVTVNSDVHNNSTASDNNRLG (in isoform
8 and isoform 9). {ECO:0000305}.
/FTId=VSP_002921.
VAR_SEQ 463 473 PSSVISNDDDS -> FVLFHKIPLDG (in isoform 6,
isoform 7, isoform 8, isoform 9, isoform
10 and isoform 12).
{ECO:0000303|PubMed:7959025}.
/FTId=VSP_002918.
VAR_SEQ 468 818 Missing (in isoform 11). {ECO:0000305}.
/FTId=VSP_002917.
VAR_SEQ 474 818 Missing (in isoform 6, isoform 7, isoform
8, isoform 9, isoform 10 and isoform 12).
{ECO:0000303|PubMed:7959025}.
/FTId=VSP_002919.
SEQUENCE 818 AA; 91737 MW; D1BA39E2092B2152 CRC64;
MVSWRRRPGP GLARLWGLCC LVLGCWRGAL GCPASCRCSS WRIWCSEPVP GITSFPVPQR
STEDDNVTEI YIANQRKLES INDNEVGFYV GLKNLTVVDS GLRFVSRQAF VKNINLQYIN
LSRNKLSSLS KKPFRHLGLS DLILVDNPFK CSCEIMWIKK FQETKFYTEA QDIYCVDDNN
KRIALMDMKV PNCDLPSANL SNYNITVVEG KSITLYCDTT GGPPPNVSWV LTNLVSNHES
DTSKNPASLT IKNVSSMDSG LWISCVAENI VGEVQTSAEL TVFFAPNITF IESPTPDHHW
CIPFTVKGNP KPTLQWFYEG AILNESEYIC TKIHVINQSE YHGCLQLDNP THLNNGAYTL
LAKNEYGEDE KRVDAHFMSV PGDGSGPIVD PDVYEYETTP NDLGDTTNNS NQITSPDVSN
KENEDSITVY VVVGIAALVC TGLVIMLIIL KFGRHSKFGM KGPSSVISND DDSASPLHHI
SNGSNTPSSS EGGPDAVIIG MTKIPVIENP QYFGITNSQL KPDTFVQHIK RHNIVLKREL
GEGAFGKVFL AECYNLCPEQ DKILVAVKTL KDASDNARKD FHREAELLTN LQHEHIVKFY
GVCVEGDPLI MVFEYMKHGD LNKFLRAHGP DAVLMAEGNR PAELTQSQML HIAQQIAAGM
VYLASQHFVH RDLATRNCLV GENLLVKIGD FGMSRDVYST DYYRVGGHTM LPIRWMPPES
IMYRKFTTES DVWSLGVVLW EIFTYGKQPW YQLSNNEVIE CITQGRVLQR PRTCPKEVYD
LMLGCWQREP HMRLNIKEIH SLLQNLAKAS PVYLDILG


Related products :

Catalog number Product name Quantity
EIAAB28077 BDNF_NT-3 growth factors receptor,GP145-TrkB_GP95-TrkB,Mouse,Mus musculus,Neurotrophic tyrosine kinase receptor type 2,Ntrk2,Trkb,Trk-B,TrkB tyrosine kinase
EIAAB28078 BDNF_NT-3 growth factors receptor,GP145-TrkB,Homo sapiens,Human,Neurotrophic tyrosine kinase receptor type 2,NTRK2,TRKB,Trk-B,TrkB tyrosine kinase
EIAAB28079 BDNF_NT-3 growth factors receptor,GP145-TrkB_GP95-TrkB,Neurotrophic tyrosine kinase receptor type 2,Ntrk2,Rat,Rattus norvegicus,Trkb,Trk-B,TrkB tyrosine kinase
EIAAB28080 BDNF_NT-3 growth factors receptor,Chicken,Gallus gallus,Neurotrophic tyrosine kinase receptor type 2,NTRK2,TRKB,Trk-B,TrkB tyrosine kinase
20-272-191629 TrkB - Mouse monoclonal [1.A.37] to TrkB; EC 2.7.10.1; Neurotrophic tyrosine kinase receptor type 2; TrkB tyrosine kinase; GP145-TrkB; Trk-B Monoclonal 0.025 mg
18-272-195244 TrkB - Goat polyclonal to TrkB; EC 2.7.10.1; Neurotrophic tyrosine kinase receptor type 2; TrkB tyrosine kinase; GP145-TrkB; Trk-B Polyclonal 0.025 mg
10-782-55075 High affinity nerve growth factor receptor - EC 2.7.10.1; Neurotrophic tyrosine kinase receptor type 1; TRK1 transforming tyrosine kinase protein; p140-TrkA; Trk-A N_A 0.01 mg
10-782-55075 High affinity nerve growth factor receptor - EC 2.7.10.1; Neurotrophic tyrosine kinase receptor type 1; TRK1 transforming tyrosine kinase protein; p140-TrkA; Trk-A N_A 0.02 mg
10-782-55075 High affinity nerve growth factor receptor - EC 2.7.10.1; Neurotrophic tyrosine kinase receptor type 1; TRK1 transforming tyrosine kinase protein; p140-TrkA; Trk-A N_A 0.001 mg
10-782-55075 High affinity nerve growth factor receptor - EC 2.7.10.1; Neurotrophic tyrosine kinase receptor type 1; TRK1 transforming tyrosine kinase protein; p140-TrkA; Trk-A N_A 0.005 mg
EIAAB28073 High affinity nerve growth factor receptor,Homo sapiens,Human,Neurotrophic tyrosine kinase receptor type 1,NTRK1,p140-TrkA,TRK,TRK1-transforming tyrosine kinase protein,Trk-A
EIAAB28082 GP145-TrkC,Homo sapiens,Human,Neurotrophic tyrosine kinase receptor type 3,NT-3 growth factor receptor,NTRK3,TRKC,Trk-C,TrkC tyrosine kinase
EIAAB28085 GP145-TrkC,Mouse,Mus musculus,Neurotrophic tyrosine kinase receptor type 3,NT-3 growth factor receptor,Ntrk3,TrkC,Trk-C,TrkC tyrosine kinase
EIAAB28084 GP145-TrkC,Neurotrophic tyrosine kinase receptor type 3,NT-3 growth factor receptor,Ntrk3,Rat,Rattus norvegicus,Trkc,Trk-C,TrkC tyrosine kinase
EIAAB28081 GP145-TrkC,Neurotrophic tyrosine kinase receptor type 3,NT-3 growth factor receptor,NTRK3,Pig,Sus scrofa,TRKC,Trk-C,TrkC tyrosine kinase
EIAAB13072 EPH,EPH tyrosine kinase,EPH tyrosine kinase 1,EPHA1,Ephrin type-A receptor 1,EPHT,EPHT1,Erythropoietin-producing hepatoma receptor,hEpha1,Homo sapiens,Human,Tyrosine-protein kinase receptor EPH
EIAAB13105 Ephb2,Ephrin type-B receptor 2,Epth3,Mouse,Mus musculus,Neural kinase,Nuk,Nuk receptor tyrosine kinase,Sek3,Tyrosine-protein kinase receptor EPH-3,Tyrosine-protein kinase receptor SEK-3
EIAAB28083 Chicken,Gallus gallus,Neurotrophic tyrosine kinase receptor type 3,NT-3 growth factor receptor,NTRK3,TRKC,Trk-C,TrkC tyrosine kinase
EIAAB13074 Eck,Epha2,Ephrin type-A receptor 2,Epithelial cell kinase,Mouse,Mus musculus,Myk2,Sek2,Tyrosine-protein kinase receptor ECK,Tyrosine-protein kinase receptor MPK-5,Tyrosine-protein kinase receptor SEK-
C507 Recombinant Human Neurotrophic Tyrosine Kinase Receptor Type 2 per TrkB per NTRK2 (C-6His) 10ug
E0039h ELISA kit CD135,Fetal liver kinase-2,FL cytokine receptor,FLK2,FLK-2,FLT3,FLT-3,Fms-like tyrosine kinase 3,Homo sapiens,Human,Receptor-type tyrosine-protein kinase FLT3,Stem cell tyrosine kinase 1,ST 96T
U0039h CLIA CD135,Fetal liver kinase-2,FL cytokine receptor,FLK2,FLK-2,FLT3,FLT-3,Fms-like tyrosine kinase 3,Homo sapiens,Human,Receptor-type tyrosine-protein kinase FLT3,Stem cell tyrosine kinase 1,STK1,STK 96T
E0039h ELISA CD135,Fetal liver kinase-2,FL cytokine receptor,FLK2,FLK-2,FLT3,FLT-3,Fms-like tyrosine kinase 3,Homo sapiens,Human,Receptor-type tyrosine-protein kinase FLT3,Stem cell tyrosine kinase 1,STK1,ST 96T
E0147m ELISA Embryonic receptor kinase 2,Emrk2,Flt,Flt1,FLT-1,Fms-like tyrosine kinase 1,Mouse,Mus musculus,Tyrosine-protein kinase receptor FLT,Vascular endothelial growth factor receptor 1,VEGFR-1 96T
U0147m CLIA Embryonic receptor kinase 2,Emrk2,Flt,Flt1,FLT-1,Fms-like tyrosine kinase 1,Mouse,Mus musculus,Tyrosine-protein kinase receptor FLT,Vascular endothelial growth factor receptor 1,VEGFR-1 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur