Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)

 B2CL1_CHICK             Reviewed;         229 AA.
Q07816; Q98908;
01-FEB-1995, integrated into UniProtKB/Swiss-Prot.
01-NOV-1997, sequence version 2.
05-DEC-2018, entry version 145.
RecName: Full=Bcl-2-like protein 1;
Short=Bcl2-L-1;
AltName: Full=Apoptosis regulator Bcl-X;
Name=BCL2L1; Synonyms=BCL-X, BCLX;
Gallus gallus (Chicken).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
Phasianidae; Phasianinae; Gallus.
NCBI_TaxID=9031;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM SHORT).
PubMed=8358789; DOI=10.1016/0092-8674(93)90508-N;
Boise L.H., Gonzalez-Garcia M., Postema C.E., Ding L., Lindsten T.,
Turka L.A., Mao X., Nunez G., Thompson C.B.;
"bcl-x, a bcl-2-related gene that functions as a dominant regulator of
apoptotic cell death.";
Cell 74:597-608(1993).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG).
STRAIN=Hubbard White Mountain; TISSUE=Testis;
PubMed=9110311;
DOI=10.1002/(SICI)1098-2795(199705)47:1<26::AID-MRD4>3.0.CO;2-S;
Vilagrasa X., Mezquita C., Mezquita J.;
"Differential expression of bcl-2 and bcl-x during chicken
spermatogenesis.";
Mol. Reprod. Dev. 47:26-29(1997).
-!- FUNCTION: Dominant regulator of apoptotic cell death. The long
form displays cell death repressor activity, whereas the short
isoform promotes apoptosis. Also acts as a regulator of G2
checkpoint and progression to cytokinesis during mitosis (By
similarity). {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Mitochondrion membrane {ECO:0000250};
Single-pass membrane protein {ECO:0000250}. Nucleus membrane
{ECO:0000250}; Single-pass membrane protein {ECO:0000250};
Cytoplasmic side {ECO:0000250}. Mitochondrion matrix
{ECO:0000250}. Cytoplasm, cytoskeleton, microtubule organizing
center, centrosome {ECO:0000250}. Cytoplasm, cytosol
{ECO:0000250}. Cytoplasmic vesicle, secretory vesicle, synaptic
vesicle membrane {ECO:0000250}. Note=After neuronal stimulation,
translocates from cytosol to synaptic vesicle and mitochondrion
membrane in a calmodulin-dependent manner. {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=Long;
IsoId=Q07816-1; Sequence=Displayed;
Name=Short;
IsoId=Q07816-2; Sequence=VSP_000514;
-!- TISSUE SPECIFICITY: Highest expression in organs with lymphoid
development.
-!- DOMAIN: The BH4 motif seems to be involved in the anti-apoptotic
function. Intact BH1 and BH2 motifs are required for anti-
apoptotic activity (By similarity). {ECO:0000250}.
-!- SIMILARITY: Belongs to the Bcl-2 family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; Z23110; CAA80657.1; -; Genomic_DNA.
EMBL; U26645; AAB07677.1; -; mRNA.
PIR; A47537; A47537.
RefSeq; NP_001020475.1; NM_001025304.1. [Q07816-1]
RefSeq; XP_015151803.1; XM_015296317.1. [Q07816-1]
RefSeq; XP_015151804.1; XM_015296318.1. [Q07816-1]
RefSeq; XP_015151805.1; XM_015296319.1. [Q07816-1]
RefSeq; XP_015151806.1; XM_015296320.1. [Q07816-1]
UniGene; Gga.4944; -.
ProteinModelPortal; Q07816; -.
STRING; 9031.ENSGALP00000010059; -.
PaxDb; Q07816; -.
Ensembl; ENSGALT00000010026; ENSGALP00000010012; ENSGALG00000006211. [Q07816-1]
Ensembl; ENSGALT00000010073; ENSGALP00000010059; ENSGALG00000006211. [Q07816-1]
Ensembl; ENSGALT00000078202; ENSGALP00000054103; ENSGALG00000006211. [Q07816-2]
GeneID; 373954; -.
KEGG; gga:373954; -.
CTD; 598; -.
eggNOG; KOG4728; Eukaryota.
eggNOG; ENOG41123S0; LUCA.
GeneTree; ENSGT00530000062935; -.
HOGENOM; HOG000056452; -.
InParanoid; Q07816; -.
KO; K04570; -.
OMA; NGSPSWH; -.
OrthoDB; EOG091G0OCU; -.
PhylomeDB; Q07816; -.
TreeFam; TF315834; -.
Reactome; R-GGA-111453; BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.
PRO; PR:Q07816; -.
Proteomes; UP000000539; Chromosome 20.
Bgee; ENSGALG00000006211; Expressed in 10 organ(s), highest expression level in lung.
GO; GO:0097136; C:Bcl-2 family protein complex; IEA:Ensembl.
GO; GO:0030054; C:cell junction; IEA:UniProtKB-KW.
GO; GO:0005813; C:centrosome; ISS:UniProtKB.
GO; GO:0005829; C:cytosol; IEA:UniProtKB-SubCell.
GO; GO:0005783; C:endoplasmic reticulum; IEA:Ensembl.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005759; C:mitochondrial matrix; IEA:UniProtKB-SubCell.
GO; GO:0005741; C:mitochondrial outer membrane; IBA:GO_Central.
GO; GO:0031965; C:nuclear membrane; IEA:UniProtKB-SubCell.
GO; GO:0030672; C:synaptic vesicle membrane; IEA:UniProtKB-SubCell.
GO; GO:0051434; F:BH3 domain binding; IEA:Ensembl.
GO; GO:0046982; F:protein heterodimerization activity; IBA:GO_Central.
GO; GO:0042803; F:protein homodimerization activity; IBA:GO_Central.
GO; GO:0019901; F:protein kinase binding; IEA:Ensembl.
GO; GO:0071839; P:apoptotic process in bone marrow cell; IEA:Ensembl.
GO; GO:0008283; P:cell proliferation; IEA:Ensembl.
GO; GO:0060154; P:cellular process regulating host cell cycle in response to virus; IEA:Ensembl.
GO; GO:0071312; P:cellular response to alkaloid; IEA:Ensembl.
GO; GO:0071230; P:cellular response to amino acid stimulus; IEA:Ensembl.
GO; GO:0071480; P:cellular response to gamma radiation; IEA:Ensembl.
GO; GO:0097192; P:extrinsic apoptotic signaling pathway in absence of ligand; IBA:GO_Central.
GO; GO:0009566; P:fertilization; IEA:Ensembl.
GO; GO:0007281; P:germ cell development; IEA:Ensembl.
GO; GO:0097284; P:hepatocyte apoptotic process; IEA:Ensembl.
GO; GO:0008630; P:intrinsic apoptotic signaling pathway in response to DNA damage; IBA:GO_Central.
GO; GO:0008584; P:male gonad development; IEA:Ensembl.
GO; GO:0070584; P:mitochondrion morphogenesis; IEA:Ensembl.
GO; GO:0007093; P:mitotic cell cycle checkpoint; ISS:UniProtKB.
GO; GO:0043066; P:negative regulation of apoptotic process; IBA:GO_Central.
GO; GO:1902236; P:negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway; IEA:Ensembl.
GO; GO:1900118; P:negative regulation of execution phase of apoptosis; IEA:Ensembl.
GO; GO:1902042; P:negative regulation of extrinsic apoptotic signaling pathway via death domain receptors; IEA:Ensembl.
GO; GO:2001243; P:negative regulation of intrinsic apoptotic signaling pathway; IBA:GO_Central.
GO; GO:1902230; P:negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage; IEA:Ensembl.
GO; GO:0043524; P:negative regulation of neuron apoptotic process; IEA:Ensembl.
GO; GO:1903077; P:negative regulation of protein localization to plasma membrane; IEA:Ensembl.
GO; GO:0051402; P:neuron apoptotic process; IEA:Ensembl.
GO; GO:0001541; P:ovarian follicle development; IEA:Ensembl.
GO; GO:0008284; P:positive regulation of cell proliferation; IEA:Ensembl.
GO; GO:0032465; P:regulation of cytokinesis; ISS:UniProtKB.
GO; GO:0040008; P:regulation of growth; IEA:Ensembl.
GO; GO:0046902; P:regulation of mitochondrial membrane permeability; IEA:Ensembl.
GO; GO:0051881; P:regulation of mitochondrial membrane potential; IEA:Ensembl.
GO; GO:0001836; P:release of cytochrome c from mitochondria; IEA:Ensembl.
GO; GO:0046898; P:response to cycloheximide; IEA:Ensembl.
GO; GO:0034097; P:response to cytokine; IEA:Ensembl.
GO; GO:0007283; P:spermatogenesis; IEA:Ensembl.
GO; GO:0019050; P:suppression by virus of host apoptotic process; IEA:Ensembl.
Gene3D; 1.10.437.10; -; 1.
InterPro; IPR013279; Apop_reg_BclX.
InterPro; IPR002475; Bcl2-like.
InterPro; IPR004725; Bcl2/BclX.
InterPro; IPR020717; Bcl2_BH1_motif_CS.
InterPro; IPR020726; Bcl2_BH2_motif_CS.
InterPro; IPR020728; Bcl2_BH3_motif_CS.
InterPro; IPR003093; Bcl2_BH4.
InterPro; IPR020731; Bcl2_BH4_motif_CS.
InterPro; IPR036834; Blc2-like_sf.
InterPro; IPR026298; Blc2_fam.
PANTHER; PTHR11256; PTHR11256; 1.
PANTHER; PTHR11256:SF12; PTHR11256:SF12; 1.
Pfam; PF00452; Bcl-2; 1.
Pfam; PF02180; BH4; 1.
PRINTS; PR01864; APOPREGBCLX.
PRINTS; PR01862; BCL2FAMILY.
SMART; SM00265; BH4; 1.
SUPFAM; SSF56854; SSF56854; 1.
TIGRFAMs; TIGR00865; bcl-2; 1.
PROSITE; PS50062; BCL2_FAMILY; 1.
PROSITE; PS01080; BH1; 1.
PROSITE; PS01258; BH2; 1.
PROSITE; PS01259; BH3; 1.
PROSITE; PS01260; BH4_1; 1.
PROSITE; PS50063; BH4_2; 1.
2: Evidence at transcript level;
Alternative splicing; Apoptosis; Cell junction; Complete proteome;
Cytoplasm; Cytoplasmic vesicle; Cytoskeleton; Membrane; Mitochondrion;
Nucleus; Reference proteome; Synapse; Transmembrane;
Transmembrane helix.
CHAIN 1 229 Bcl-2-like protein 1.
/FTId=PRO_0000143061.
TRANSMEM 206 223 Helical. {ECO:0000255}.
MOTIF 4 24 BH4.
MOTIF 82 96 BH3.
MOTIF 125 144 BH1.
MOTIF 176 191 BH2.
VAR_SEQ 185 229 ERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSL
LSRK -> VRTALP (in isoform Short).
{ECO:0000305}.
/FTId=VSP_000514.
SEQUENCE 229 AA; 25733 MW; A97D3A4D04C0E9DA CRC64;
MSSSNRELVI DFVSYKLSQR GHCWSELEEE DENRTDTAAE AEMDSVLNGS PSWHPPAGHV
VNGATVHRSS LEVHEIVRAS DVRQALRDAG DEFELRYRRA FSDLTSQLHI TPGTAYQSFE
QVVNELFHDG VNWGRIVAFF SFGGALCVES VDKEMRVLVG RIVSWMTTYL TDHLDPWIQE
NGGWERFVDL YGNNAAAELR KGQETFNKWL LTGATVAGVL LLGSLLSRK


Related products :

Catalog number Product name Quantity
U1343h CLIA Apoptosis regulator BAX,BAX,BCL2L4,Bcl2-L-4,Bcl-2-like protein 4,Homo sapiens,Human 96T
E1343h ELISA kit Apoptosis regulator BAX,BAX,BCL2L4,Bcl2-L-4,Bcl-2-like protein 4,Homo sapiens,Human 96T
E1343h ELISA Apoptosis regulator BAX,BAX,BCL2L4,Bcl2-L-4,Bcl-2-like protein 4,Homo sapiens,Human 96T
CSB-EL002611BO Bovine Apoptosis regulator Bcl-2(BCL2) ELISA kit 96T
CSB-EL002611CH Chicken Apoptosis regulator Bcl-2(BCL2) ELISA kit 96T
U0778b CLIA Apoptosis regulator Bcl-2,BCL2,Bos taurus,Bovine 96T
CSB-EL002611BO Bovine Apoptosis regulator Bcl-2(BCL2) ELISA kit SpeciesBovine 96T
CSB-EL002611CH Chicken Apoptosis regulator Bcl-2(BCL2) ELISA kit SpeciesChicken 96T
E0778b ELISA kit Apoptosis regulator Bcl-2,BCL2,Bos taurus,Bovine 96T
U0778m CLIA Apoptosis regulator Bcl-2,Bcl2,Bcl-2,Mouse,Mus musculus 96T
E0778m ELISA Apoptosis regulator Bcl-2,Bcl2,Bcl-2,Mouse,Mus musculus 96T
E0778r ELISA Apoptosis regulator Bcl-2,Bcl2,Bcl-2,Rat,Rattus norvegicus 96T
E0778m ELISA kit Apoptosis regulator Bcl-2,Bcl2,Bcl-2,Mouse,Mus musculus 96T
U0778r CLIA Apoptosis regulator Bcl-2,Bcl2,Bcl-2,Rat,Rattus norvegicus 96T
E0778r ELISA kit Apoptosis regulator Bcl-2,Bcl2,Bcl-2,Rat,Rattus norvegicus 96T
E0778b ELISA Apoptosis regulator Bcl-2,BCL2,Bos taurus,Bovine 96T
E0778b ELISA Kit FOR Apoptosis regulator Bcl-2; organism: Bovine; gene name: BCL2 96T
E0778h ELISA kit Apoptosis regulator Bcl-2,BCL2,Homo sapiens,Human 96T
U0778h CLIA Apoptosis regulator Bcl-2,BCL2,Homo sapiens,Human 96T
E0778h ELISA Apoptosis regulator Bcl-2,BCL2,Homo sapiens,Human 96T
GWB-E2C8B2 Apoptosis Regulator Bcl-2 (BCL2) Rabbit anti-Human Polyclonal (Thr56) Antibody
GWB-47C732 Apoptosis Regulator Bcl-2 (BCL2) Rabbit anti-Human Polyclonal (Ser70) Antibody
E0778c ELISA kit Apoptosis regulator Bcl-2,BCL2,BCL-2,Chicken,Gallus gallus 96T
E0778c ELISA Apoptosis regulator Bcl-2,BCL2,BCL-2,Chicken,Gallus gallus 96T
U0778c CLIA Apoptosis regulator Bcl-2,BCL2,BCL-2,Chicken,Gallus gallus 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur | Gentaur





GENTAUR Ltd.
Unicorn House, Station Cl
Hertfordshire, Potters Bar EN6 1TL
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017
RIB 30004 00187 00010092253 10
BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG
IBAN FR76 3000 4001 8700 0100 9225 310
france@gentaur.com | Gentaur | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur | Gentaur