Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Beta-microseminoprotein (Immunoglobulin-binding factor) (IGBF) (PN44) (Prostate secreted seminal plasma protein) (Prostate secretory protein of 94 amino acids) (PSP-94) (PSP94) (Seminal plasma beta-inhibin)

 MSMB_HUMAN              Reviewed;         114 AA.
P08118; B1API6; P11999; Q13125; Q6IAY9; Q9UC59;
01-AUG-1988, integrated into UniProtKB/Swiss-Prot.
01-AUG-1988, sequence version 1.
22-NOV-2017, entry version 166.
RecName: Full=Beta-microseminoprotein;
AltName: Full=Immunoglobulin-binding factor;
Short=IGBF;
AltName: Full=PN44;
AltName: Full=Prostate secreted seminal plasma protein;
AltName: Full=Prostate secretory protein of 94 amino acids;
Short=PSP-94;
Short=PSP94;
AltName: Full=Seminal plasma beta-inhibin;
Flags: Precursor;
Name=MSMB; Synonyms=PRSP;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSP94).
PubMed=3829888; DOI=10.1089/dna.1987.6.23;
Mbikay M., Nolet S., Fournier S., Benjannet S., Chapdelaine P.,
Paradis G., Dube J.Y., Tremblay R., Lazure C., Seidah N.G.,
Chretien M.;
"Molecular cloning and sequence of the cDNA for a 94-amino-acid
seminal plasma protein secreted by the human prostate.";
DNA 6:23-29(1987).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSP94).
PubMed=2590204; DOI=10.1016/0006-291X(89)91812-3;
Ulvsbaeck M., Lindstroem C., Weiber H., Abrahamsson P.-A., Lilja H.,
Lundwall A.;
"Molecular cloning of a small prostate protein, known as beta-
microseminoprotein, PSP94 or beta-inhibin, and demonstration of
transcripts in non-genital tissues.";
Biochem. Biophys. Res. Commun. 164:1310-1315(1989).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=2322265; DOI=10.1016/0006-291X(90)90648-7;
Green C.B., Liu W.Y., Kwok S.C.M.;
"Cloning and nucleotide sequence analysis of the human beta-
microseminoprotein gene.";
Biochem. Biophys. Res. Commun. 167:1184-1190(1990).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=2054385; DOI=10.1016/0167-4781(91)90016-F;
Nolet S., Mbikay M., Chretien M.;
"Prostatic secretory protein PSP94: gene organization and promoter
sequence in rhesus monkey and human.";
Biochim. Biophys. Acta 1089:247-249(1991).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSP94).
TISSUE=Prostate;
PubMed=7506990; DOI=10.1016/0304-3835(93)90049-F;
Liu A.Y., Bradner R.C., Vessella R.L.;
"Decreased expression of prostatic secretory protein PSP94 in prostate
cancer.";
Cancer Lett. 74:91-99(1993).
[6]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSP57), AND TISSUE SPECIFICITY.
TISSUE=Prostate;
PubMed=7566962;
Xuan J.W., Chin J.L., Guo Y., Chambers A.F., Finkelman M.A.,
Clarke M.W.;
"Alternative splicing of PSP94 (prostatic secretory protein of 94
amino acids) mRNA in prostate tissue.";
Oncogene 11:1041-1047(1995).
[7]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSP94).
Baijal-Gupta M., Clarke M.W.;
"Prostate specific protein (PSP94) expression in a human endometrial
cell line (KLE).";
Submitted (DEC-1996) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PSP94).
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PSP94).
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
"Cloning of human full open reading frames in Gateway(TM) system entry
vector (pDONR201).";
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164054; DOI=10.1038/nature02462;
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L.,
Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K.,
Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L.,
Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P.,
Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J.,
Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J.,
Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D.,
Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L.,
Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S.,
Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L.,
Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J.,
Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M.,
Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S.,
Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M.,
Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A.,
Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T.,
Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I.,
Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T.,
Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M.,
Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W.,
Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H.,
Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L.,
Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K.,
Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T.,
Doucette-Stamm L., Beck S., Smith D.R., Rogers J.;
"The DNA sequence and comparative analysis of human chromosome 10.";
Nature 429:375-381(2004).
[11]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PSP94).
TISSUE=Prostate;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[12]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 2-72.
PubMed=10491085; DOI=10.1046/j.1432-1327.1999.00614.x;
Maekinen M., Valtonen-Andre C., Lundwall A.;
"New world, but not old world, monkeys carry several genes encoding
beta-microseminoprotein.";
Eur. J. Biochem. 264:407-414(1999).
[13]
PROTEIN SEQUENCE OF 21-113.
PubMed=3995056; DOI=10.1016/0167-4838(85)90200-6;
Akiyama K., Yoshioka Y., Schmid K., Offner G.D., Troxler R.F.,
Tsuda R., Hara M.;
"The amino acid sequence of human beta-microseminoprotein.";
Biochim. Biophys. Acta 829:288-294(1985).
[14]
PROTEIN SEQUENCE OF 21-114.
PubMed=6434350; DOI=10.1016/0014-5793(84)80766-8;
Seidah N.G., Arbatti N.J., Rochemont J., Sheth A.R., Chretien M.;
"Complete amino acid sequence of human seminal plasma beta-inhibin.
Prediction of post Gln-Arg cleavage as a maturation site.";
FEBS Lett. 175:349-355(1984).
[15]
PROTEIN SEQUENCE OF 21-50 AND 113-114.
PubMed=1930232; DOI=10.1016/S0006-291X(05)81300-2;
Liang Z.G., Kamada M., Koide S.S.;
"Structural identity of immunoglobulin binding factor and prostatic
secretory protein of human seminal plasma.";
Biochem. Biophys. Res. Commun. 180:356-359(1991).
[16]
PROTEIN SEQUENCE OF 21-41, AND TISSUE SPECIFICITY.
TISSUE=Semen;
PubMed=7671139; DOI=10.1016/1357-2725(95)00021-G;
Ohkubo I., Tada T., Ochiai Y., Ueyama H., Eimoto T., Sasaki M.;
"Human seminal plasma beta-microseminoprotein: its purification,
characterization, and immunohistochemical localization.";
Int. J. Biochem. Cell Biol. 27:603-611(1995).
[17]
PROTEIN SEQUENCE OF 21-32.
PubMed=11788998;
DOI=10.1002/1615-9861(200201)2:1<112::AID-PROT112>3.0.CO;2-N;
Ghafouri B., Stahlbom B., Tagesson C., Lindahl M.;
"Newly identified proteins in human nasal lavage fluid from non-
smokers and smokers using two-dimensional gel electrophoresis and
peptide mass fingerprinting.";
Proteomics 2:112-120(2002).
[18]
INTERACTION WITH PI16.
PubMed=15344909; DOI=10.1042/BJ20040290;
Reeves J.R., Xuan J.W., Arfanis K., Morin C., Garde S.V., Ruiz M.T.,
Wisniewski J., Panchal C., Tanner J.E.;
"Identification, purification and characterization of a novel human
blood protein with binding affinity for prostate secretory protein of
94 amino acids.";
Biochem. J. 385:105-114(2005).
[19]
INVOLVEMENT IN SUSCEPTIBILITY TO HEREDITARY PROSTATE CANCER.
PubMed=18264096; DOI=10.1038/ng.91;
Thomas G., Jacobs K.B., Yeager M., Kraft P., Wacholder S., Orr N.,
Yu K., Chatterjee N., Welch R., Hutchinson A., Crenshaw A.,
Cancel-Tassin G., Staats B.J., Wang Z., Gonzalez-Bosquet J., Fang J.,
Deng X., Berndt S.I., Calle E.E., Feigelson H.S., Thun M.J.,
Rodriguez C., Albanes D., Virtamo J., Weinstein S., Schumacher F.R.,
Giovannucci E., Willett W.C., Cussenot O., Valeri A., Andriole G.L.,
Crawford E.D., Tucker M., Gerhard D.S., Fraumeni J.F. Jr., Hoover R.,
Hayes R.B., Hunter D.J., Chanock S.J.;
"Multiple loci identified in a genome-wide association study of
prostate cancer.";
Nat. Genet. 40:310-315(2008).
[20]
INVOLVEMENT IN SUSCEPTIBILITY TO HEREDITARY PROSTATE CANCER.
PubMed=22887727; DOI=10.1002/humu.22176;
Fitzgerald L.M., Zhang X., Kolb S., Kwon E.M., Liew Y.C.,
Hurtado-Coll A., Knudsen B.S., Ostrander E.A., Stanford J.L.;
"Investigation of the relationship between prostate cancer and MSMB
and NCOA4 genetic variants and protein expression.";
Hum. Mutat. 34:149-156(2013).
[21]
STRUCTURE BY NMR OF 21-114, AND DISULFIDE BONDS.
PubMed=16930619; DOI=10.1016/j.jmb.2006.07.029;
Ghasriani H., Teilum K., Johnsson Y., Fernlund P., Drakenberg T.;
"Solution structures of human and porcine beta-microseminoprotein.";
J. Mol. Biol. 362:502-515(2006).
[22]
X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 21-114, SUBUNIT, AND
DISULFIDE BONDS.
PubMed=20184897; DOI=10.1016/j.jmb.2010.02.035;
Kumar A., Jagtap D.D., Mahale S.D., Kumar M.;
"Crystal structure of prostate secretory protein PSP94 shows an edge-
to-edge association of two monomers to form a homodimer.";
J. Mol. Biol. 397:947-956(2010).
-!- SUBUNIT: Homodimer; Interacts with PI16.
{ECO:0000269|PubMed:15344909, ECO:0000269|PubMed:20184897}.
-!- INTERACTION:
O43765:SGTA; NbExp=3; IntAct=EBI-10195681, EBI-347996;
-!- SUBCELLULAR LOCATION: Secreted. Note=Sperm surface.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=PSP94;
IsoId=P08118-1; Sequence=Displayed;
Name=PSP57;
IsoId=P08118-2; Sequence=VSP_003275, VSP_003276;
-!- TISSUE SPECIFICITY: Strongly expressed in prostate, liver, kidney,
breast and penis. Also expressed in pancreas, esophagus, stomach,
deodenum, colon, trachea, lung, salivary glands and fallopian
tube. PSP94 is expressed in lung and breast, whereas PSP57 is
found in kidney and bladder. {ECO:0000269|PubMed:7566962,
ECO:0000269|PubMed:7671139}.
-!- DISEASE: Prostate cancer, hereditary, 13 (HPC13) [MIM:611928]: A
condition associated with familial predisposition to cancer of the
prostate. Most prostate cancers are adenocarcinomas that develop
in the acini of the prostatic ducts. Other rare histopathologic
types of prostate cancer that occur in approximately 5% of
patients include small cell carcinoma, mucinous carcinoma,
prostatic ductal carcinoma, transitional cell carcinoma, squamous
cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma
(basaloid), signet-ring cell carcinoma and neuroendocrine
carcinoma. Note=Disease susceptibility is associated with
variations affecting the gene represented in this entry.
-!- MISCELLANEOUS: Specific receptors for this protein are found on
spermatozoa and in the prostate.
-!- SIMILARITY: Belongs to the beta-microseminoprotein family.
{ECO:0000305}.
-!- CAUTION: Was originally thought to inhibit the secretion of FSH by
pituitary cells. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; M15885; AAA36635.1; -; mRNA.
EMBL; M34376; AAA59871.1; -; Genomic_DNA.
EMBL; M34373; AAA59871.1; JOINED; Genomic_DNA.
EMBL; M34374; AAA59871.1; JOINED; Genomic_DNA.
EMBL; M34375; AAA59871.1; JOINED; Genomic_DNA.
EMBL; X57928; CAA41002.1; -; Genomic_DNA.
EMBL; X57929; CAA41002.1; JOINED; Genomic_DNA.
EMBL; X57930; CAA41002.1; JOINED; Genomic_DNA.
EMBL; X57931; CAA41002.1; JOINED; Genomic_DNA.
EMBL; S67815; AAB29732.1; -; mRNA.
EMBL; U22178; AAA83556.1; -; mRNA.
EMBL; U78976; AAB37355.1; -; mRNA.
EMBL; BT006816; AAP35462.1; -; mRNA.
EMBL; CR457015; CAG33296.1; -; mRNA.
EMBL; AL450342; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC005257; AAH05257.1; -; mRNA.
EMBL; AJ133356; CAB39325.1; -; Genomic_DNA.
CCDS; CCDS73095.1; -. [P08118-2]
CCDS; CCDS73096.1; -. [P08118-1]
PIR; A34567; A34567.
PIR; G01730; G01730.
RefSeq; NP_002434.1; NM_002443.3. [P08118-1]
RefSeq; NP_619540.1; NM_138634.2. [P08118-2]
UniGene; Hs.255462; -.
PDB; 2IZ3; NMR; -; A=21-114.
PDB; 3IX0; X-ray; 2.30 A; A/B/C/D=21-114.
PDBsum; 2IZ3; -.
PDBsum; 3IX0; -.
ProteinModelPortal; P08118; -.
SMR; P08118; -.
BioGrid; 110583; 2.
IntAct; P08118; 1.
STRING; 9606.ENSP00000351363; -.
iPTMnet; P08118; -.
PhosphoSitePlus; P08118; -.
BioMuta; MSMB; -.
DMDM; 131436; -.
PaxDb; P08118; -.
PeptideAtlas; P08118; -.
PRIDE; P08118; -.
DNASU; 4477; -.
Ensembl; ENST00000581478; ENSP00000462641; ENSG00000263639. [P08118-2]
Ensembl; ENST00000582163; ENSP00000463092; ENSG00000263639. [P08118-1]
GeneID; 4477; -.
KEGG; hsa:4477; -.
UCSC; uc001jiq.5; human. [P08118-1]
CTD; 4477; -.
DisGeNET; 4477; -.
EuPathDB; HostDB:ENSG00000263639.5; -.
GeneCards; MSMB; -.
HGNC; HGNC:7372; MSMB.
HPA; CAB026357; -.
HPA; HPA051257; -.
MalaCards; MSMB; -.
MIM; 157145; gene.
MIM; 611928; phenotype.
neXtProt; NX_P08118; -.
OpenTargets; ENSG00000263639; -.
Orphanet; 1331; Familial prostate cancer.
PharmGKB; PA31177; -.
eggNOG; ENOG410J3M2; Eukaryota.
eggNOG; ENOG410Y4MW; LUCA.
GeneTree; ENSGT00390000010587; -.
HOGENOM; HOG000113668; -.
HOVERGEN; HBG031716; -.
InParanoid; P08118; -.
OMA; CKYIVVE; -.
OrthoDB; EOG091G0YU5; -.
PhylomeDB; P08118; -.
TreeFam; TF338336; -.
EvolutionaryTrace; P08118; -.
GeneWiki; MSMB; -.
GenomeRNAi; 4477; -.
PRO; PR:P08118; -.
Proteomes; UP000005640; Chromosome 10.
Bgee; ENSG00000263639; -.
CleanEx; HS_MSMB; -.
Genevisible; P08118; HS.
GO; GO:0005615; C:extracellular space; TAS:ProtInc.
GO; GO:0005634; C:nucleus; TAS:ProtInc.
InterPro; IPR008735; PSP94.
PANTHER; PTHR10500; PTHR10500; 1.
Pfam; PF05825; PSP94; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome;
Direct protein sequencing; Disulfide bond; Polymorphism;
Reference proteome; Secreted; Signal.
SIGNAL 1 20 {ECO:0000269|PubMed:11788998,
ECO:0000269|PubMed:1930232,
ECO:0000269|PubMed:3995056,
ECO:0000269|PubMed:6434350,
ECO:0000269|PubMed:7671139}.
CHAIN 21 114 Beta-microseminoprotein.
/FTId=PRO_0000019268.
DISULFID 22 70
DISULFID 38 62
DISULFID 57 93
DISULFID 60 69
DISULFID 84 107
VAR_SEQ 37 77 KCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPV
-> MFLHLWVMTKTTAKESSRRRTASISWWRRRTQKRPVLS
VNG (in isoform PSP57).
{ECO:0000303|PubMed:7566962}.
/FTId=VSP_003275.
VAR_SEQ 78 114 Missing (in isoform PSP57).
{ECO:0000303|PubMed:7566962}.
/FTId=VSP_003276.
VARIANT 17 17 L -> S (in dbSNP:rs1804776).
/FTId=VAR_011935.
VARIANT 25 25 I -> M (in dbSNP:rs1804778).
/FTId=VAR_011936.
VARIANT 52 52 W -> R (in dbSNP:rs1804780).
/FTId=VAR_011937.
VARIANT 53 53 Q -> R (in dbSNP:rs1804468).
/FTId=VAR_011938.
VARIANT 80 80 D -> A (in dbSNP:rs1802774).
/FTId=VAR_011939.
VARIANT 87 87 I -> T (in dbSNP:rs1802771).
/FTId=VAR_011940.
VARIANT 91 91 E -> G (in dbSNP:rs1804469).
/FTId=VAR_011941.
VARIANT 92 92 D -> G (in dbSNP:rs1804461).
/FTId=VAR_011942.
VARIANT 98 98 V -> L (in dbSNP:rs1804464).
/FTId=VAR_011943.
CONFLICT 113 113 I -> G (in Ref. 14; AA sequence).
{ECO:0000305}.
STRAND 22 26 {ECO:0000244|PDB:3IX0}.
STRAND 33 35 {ECO:0000244|PDB:3IX0}.
STRAND 51 53 {ECO:0000244|PDB:3IX0}.
STRAND 57 62 {ECO:0000244|PDB:3IX0}.
STRAND 64 71 {ECO:0000244|PDB:3IX0}.
STRAND 75 79 {ECO:0000244|PDB:3IX0}.
TURN 81 83 {ECO:0000244|PDB:3IX0}.
STRAND 84 89 {ECO:0000244|PDB:3IX0}.
HELIX 90 92 {ECO:0000244|PDB:3IX0}.
STRAND 94 101 {ECO:0000244|PDB:3IX0}.
STRAND 110 113 {ECO:0000244|PDB:3IX0}.
SEQUENCE 114 AA; 12865 MW; D0B13E436D70BB1D CRC64;
MNVLLGSVVI FATFVTLCNA SCYFIPNEGV PGDSTRKCMD LKGNKHPINS EWQTDNCETC
TCYETEISCC TLVSTPVGYD KDNCQRIFKK EDCKYIVVEK KDPKKTCSVS EWII


Related products :

Catalog number Product name Quantity
EIAAB25509 Beta-microseminoprotein,Homo sapiens,Human,IGBF,Immunoglobulin-binding factor,MSMB,PN44,Prostate secreted seminal plasma protein,Prostate secretory protein of 94 amino acids,PRSP,PSP94,PSP-94,Seminal
EIAAB25508 Beta-microseminoprotein,MSMB,Pig,Prostate secreted seminal plasma protein,Prostate secretory protein of 94 amino acids,PSP94,PSP94,PSP-94,Sus scrofa,TS507
EIAAB25510 Beta-microseminoprotein,Msmb,Prostate secreted seminal plasma protein,Prostate secretory protein of 94 amino acids,PSP94,Psp94,PSP-94,Rat,Rattus norvegicus
EIAAB25507 Beta-microseminoprotein,Mouse,Msmb,Mus musculus,Prostate secreted seminal plasma protein,Prostate secretory protein of 94 amino acids,PSP94,Psp94,PSP-94
RD164335050 Prostate-Specific Antigen Seminal plasma Native protein 0.05 mg
EIAAB40655 ADP,Androgen-dependent protein,Rat,Rattus norvegicus,Seminal vesicle protein 2,Seminal vesicle secretory protein 4,Seminal vesicle secretory protein IV,Svp2,Svp4,SVS IV,SVS protein S,Svs4
RD164335050 Prostate-Specific Antigen Seminal plasma, Human Native protein 0.05 mg
EIAAB40659 Mouse,Mus musculus,Seminal vesicle protein 6,Seminal vesicle secretory protein 6,Seminal vesicle secretory protein VI,Svp6,SVS VI,Svs6,SVSP99
EIAAB29951 Calcium transport inhibitor,Caltrin,Mouse,Mus musculus,Pate4,PATE-B,PATE-like protein B,Prostate and testis expressed protein 4,Seminal vesicle protein 7,Seminal vesicle protein VII,SVS VII,Svs7
EIAAB40656 Mouse,Mus musculus,Seminal vesicle protein 2,Seminal vesicle secretory protein 4,Seminal vesicle secretory protein IV,Svp2,SVS IV,Svs4
orb81288 Human Beta-Microseminoprotein PSP94 Recombinant Human produced in E.coli is a single, non-glycosylated, polypeptide chain containing 104 amino acids and having a molecular mass of 12 kDa. The PSP94 is 2
EIAAB40658 Mouse,Mus musculus,Seminal vesicle secretory protein 5,Seminal vesicle secretory protein V,Svp5,SVS protein F,SVS V,Svs5
EIAAB40657 Rat,Rattus norvegicus,Seminal vesicle secretory protein 5,Seminal vesicle secretory protein V,Svp5,SVS protein F,SVS V,Svs5
EIAAB40654 Rat,Rattus norvegicus,Seminal vesicle secretory protein 2,Seminal vesicle secretory protein II,SVS II,Svs2
RD191140200R ELISA: Prostate Secretory Protein 94 (PSP94), Human 96 wells (1 kit)
RD191140200R ELISA Human , Prostate Secretory Protein 94 (PSP94) 96 wells (1 kit)
RD191140200R Prostate Secretory Protein 94 (PSP94) species: Human ELISA 96 wells (1 kit)
H-1602.1000 Seminal Plasma Inhibin (67_94) (human) Salt _ Binding (Disulfide_bond) Synonym b_Inhibin (67_94) SumFormula C150H240N36O43S2 1.0 mg
H-1602.0500 Seminal Plasma Inhibin (67_94) (human) Salt _ Binding (Disulfide_bond) Synonym b_Inhibin (67_94) SumFormula C150H240N36O43S2 0.5 mg
YHB2471Hu Human Prostate secretory protein94,PSP94 ELISA kit 96T
UB-E01926 Human Prostate secretory protein94(PSP94)ELISA Kit 96T
E2021Hu Human Prostate secretory protein94,PSP94 ELISA kit 96T
SL1467Hu Human Prostate secretory protein94,PSP94 ELISA kit 96T
201-12-2022 Human Prostate secretory protein94,PSP94 ELISA kit 48T
201-12-2022 Human Prostate secretory protein94(PSP94)ELISA Kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur