Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 (EC 2.8.2.8) (Glucosaminyl N-deacetylase/N-sulfotransferase 1) (NDST-1) (N-heparan sulfate sulfotransferase 1) (N-HSST 1) ([Heparan sulfate]-glucosamine N-sulfotransferase 1) (HSNST 1) [Includes: Heparan sulfate N-deacetylase 1 (EC 3.-.-.-); Heparan sulfate N-sulfotransferase 1 (EC 2.8.2.-)]

 NDST1_HUMAN             Reviewed;         882 AA.
P52848; Q96E57;
01-OCT-1996, integrated into UniProtKB/Swiss-Prot.
01-OCT-1996, sequence version 1.
20-DEC-2017, entry version 163.
RecName: Full=Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1;
EC=2.8.2.8;
AltName: Full=Glucosaminyl N-deacetylase/N-sulfotransferase 1;
Short=NDST-1;
AltName: Full=N-heparan sulfate sulfotransferase 1;
Short=N-HSST 1;
AltName: Full=[Heparan sulfate]-glucosamine N-sulfotransferase 1;
Short=HSNST 1;
Includes:
RecName: Full=Heparan sulfate N-deacetylase 1;
EC=3.-.-.-;
Includes:
RecName: Full=Heparan sulfate N-sulfotransferase 1;
EC=2.8.2.-;
Name=NDST1; Synonyms=HSST, HSST1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Placenta;
PubMed=7601448; DOI=10.1016/0888-7543(95)80206-2;
Dixon J., Loftus S.K., Gladwin A.J., Scambler P.J., Wasmuth J.J.,
Dixon M.J.;
"Cloning of the human heparan sulfate-N-deacetylase/N-sulfotransferase
gene from the Treacher Collins syndrome candidate region at 5q32-
q33.1.";
Genomics 26:239-244(1995).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND SUBCELLULAR LOCATION.
TISSUE=Umbilical vein endothelial cell;
PubMed=9230113; DOI=10.1042/bj3250351;
Humphries D.E., Sullivan B.M., Aleixo M.D., Stow J.L.;
"Localization of human heparan glucosaminyl N-deacetylase/N-
sulphotransferase to the trans-Golgi network.";
Biochem. J. 325:351-357(1997).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Fibroblast;
Labell T.L., Milewicz D.J., Bonadio J., Edelhoff S., Disteche C.M.,
Byers P.H.;
Submitted (JUN-1995) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
MUTAGENESIS OF LYS-614.
PubMed=9744796; DOI=10.1016/S0014-5793(98)00913-2;
Sueyoshi T., Kakuta Y., Pedersen L.C., Wall F.E., Pedersen L.G.,
Negishi M.;
"A role of Lys614 in the sulfotransferase activity of human heparan
sulfate N-deacetylase/N-sulfotransferase.";
FEBS Lett. 433:211-214(1998).
[6]
FUNCTION.
PubMed=10758005; DOI=10.1021/bi992524l;
Pikas D.S., Eriksson I., Kjellen L.;
"Overexpression of different isoforms of glucosaminyl N-deacetylase/N-
sulfotransferase results in distinct heparan sulfate N-sulfation
patterns.";
Biochemistry 39:4552-4558(2000).
[7]
FUNCTION, AND BIOPHYSICOCHEMICAL PROPERTIES.
PubMed=12634318; DOI=10.1093/glycob/cwg011;
van den Born J., Pikas D.S., Pisa B.J., Eriksson I., Kjellen L.,
Berden J.H.M.;
"Antibody-based assay for N-deacetylase activity of heparan
sulfate/heparin N-deacetylase/N-sulfotransferase (NDST): novel
characteristics of NDST-1 and -2.";
Glycobiology 13:1-10(2003).
[8]
FUNCTION.
PubMed=22660413; DOI=10.1038/ncb2502;
Baietti M.F., Zhang Z., Mortier E., Melchior A., Degeest G.,
Geeraerts A., Ivarsson Y., Depoortere F., Coomans C., Vermeiren E.,
Zimmermann P., David G.;
"Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.";
Nat. Cell Biol. 14:677-685(2012).
[9]
INTERACTION WITH EXT2.
PubMed=18337501; DOI=10.1073/pnas.0705807105;
Presto J., Thuveson M., Carlsson P., Busse M., Wilen M., Eriksson I.,
Kusche-Gullberg M., Kjellen L.;
"Heparan sulfate biosynthesis enzymes EXT1 and EXT2 affect NDST1
expression and heparan sulfate sulfation.";
Proc. Natl. Acad. Sci. U.S.A. 105:4751-4756(2008).
[10]
X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 579-882 IN COMPLEX WITH PAP,
AND DISULFIDE BOND.
PubMed=10196134; DOI=10.1074/jbc.274.16.10673;
Kakuta Y., Sueyoshi T., Negishi M., Pedersen L.C.;
"Crystal structure of the sulfotransferase domain of human heparan
sulfate N-deacetylase/N-sulfotransferase 1.";
J. Biol. Chem. 274:10673-10676(1999).
[11]
INVOLVEMENT IN MRT46, AND VARIANTS MRT46 SER-611; LEU-640; ASP-642 AND
GLN-709.
PubMed=25125150; DOI=10.1002/ajmg.a.36723;
Reuter M.S., Musante L., Hu H., Diederich S., Sticht H., Ekici A.B.,
Uebe S., Wienker T.F., Bartsch O., Zechner U., Oppitz C., Keleman K.,
Jamra R.A., Najmabadi H., Schweiger S., Reis A., Kahrizi K.;
"NDST1 missense mutations in autosomal recessive intellectual
disability.";
Am. J. Med. Genet. A 164A:2753-2763(2014).
-!- FUNCTION: Essential bifunctional enzyme that catalyzes both the N-
deacetylation and the N-sulfation of glucosamine (GlcNAc) of the
glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA
disaccharide repeating sugar backbone to make N-sulfated
heparosan, a prerequisite substrate for later modifications in
heparin biosynthesis (PubMed:10758005, PubMed:12634318). Plays a
role in determining the extent and pattern of sulfation of heparan
sulfate. Compared to other NDST enzymes, its presence is
absolutely required. Participates in biosynthesis of heparan
sulfate that can ultimately serve as L-selectin ligands, thereby
playing a role in inflammatory response (PubMed:10758005,
PubMed:12634318). Required for the exosomal release of SDCBP, CD63
and syndecan (PubMed:22660413). {ECO:0000269|PubMed:10758005,
ECO:0000269|PubMed:12634318, ECO:0000269|PubMed:22660413}.
-!- CATALYTIC ACTIVITY: 3'-phosphoadenylyl sulfate + [heparan
sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan
sulfate]-N-sulfoglucosamine.
-!- BIOPHYSICOCHEMICAL PROPERTIES:
Kinetic parameters:
KM=13.3 uM for K5 polysaccharide {ECO:0000269|PubMed:12634318};
KM=0.35 uM for N-acetylated HS-II {ECO:0000269|PubMed:12634318};
-!- PATHWAY: Glycan metabolism; heparan sulfate biosynthesis.
-!- PATHWAY: Glycan metabolism; heparin biosynthesis.
-!- SUBUNIT: Monomer (PubMed:10196134). Interacts with EXT2
(PubMed:18337501). {ECO:0000269|PubMed:10196134,
ECO:0000269|PubMed:18337501}.
-!- SUBCELLULAR LOCATION: Golgi apparatus membrane
{ECO:0000269|PubMed:9230113}; Single-pass type II membrane protein
{ECO:0000269|PubMed:9230113}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P52848-1; Sequence=Displayed;
Name=2;
IsoId=P52848-2; Sequence=VSP_017397, VSP_017398;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Widely expressed. Expression is most abundant
in heart, liver and pancreas.
-!- DISEASE: Mental retardation, autosomal recessive 46 (MRT46)
[MIM:616116]: A disorder characterized by significantly below
average general intellectual functioning associated with
impairments in adaptive behavior and manifested during the
developmental period. MRT46 manifestations include delayed
psychomotor development apparent from infancy or early childhood,
delayed or absent expressive speech, hypotonia, and therapy-
responsive seizures in some patients. Behavioral abnormalities are
variable and include aggression, self-injurious behavior, and
sleep disturbances. {ECO:0000269|PubMed:25125150}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- MISCELLANEOUS: The presence of 4 different heparan sulfate N-
deacetylase/N-sulfotransferase enzymes in mammals, as well as
differences in their enzyme activity suggest that some initiate
heparan sulfate modification/sulfation reactions, whereas other
later on fill in or extend already modified heparan sulfate
sequences.
-!- SIMILARITY: Belongs to the sulfotransferase 1 family. NDST
subfamily. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; U18918; AAA75281.1; -; mRNA.
EMBL; U36600; AAC27354.1; -; mRNA.
EMBL; U17970; AAA67765.1; -; mRNA.
EMBL; BC012888; AAH12888.1; -; mRNA.
CCDS; CCDS34277.1; -. [P52848-1]
PIR; A57169; A57169.
RefSeq; NP_001287992.1; NM_001301063.1.
RefSeq; NP_001534.1; NM_001543.4. [P52848-1]
RefSeq; XP_006714846.1; XM_006714783.1. [P52848-1]
RefSeq; XP_016864917.1; XM_017009428.1. [P52848-1]
RefSeq; XP_016864918.1; XM_017009429.1. [P52848-1]
RefSeq; XP_016864919.1; XM_017009430.1. [P52848-1]
RefSeq; XP_016864920.1; XM_017009431.1. [P52848-1]
UniGene; Hs.222055; -.
PDB; 1NST; X-ray; 2.30 A; A=558-882.
PDBsum; 1NST; -.
ProteinModelPortal; P52848; -.
SMR; P52848; -.
BioGrid; 109572; 16.
STRING; 9606.ENSP00000261797; -.
DrugBank; DB01812; Adenosine-3'-5'-Diphosphate.
iPTMnet; P52848; -.
PhosphoSitePlus; P52848; -.
BioMuta; NDST1; -.
EPD; P52848; -.
MaxQB; P52848; -.
PaxDb; P52848; -.
PeptideAtlas; P52848; -.
PRIDE; P52848; -.
Ensembl; ENST00000261797; ENSP00000261797; ENSG00000070614. [P52848-1]
GeneID; 3340; -.
KEGG; hsa:3340; -.
UCSC; uc003lsk.4; human. [P52848-1]
CTD; 3340; -.
DisGeNET; 3340; -.
EuPathDB; HostDB:ENSG00000070614.14; -.
GeneCards; NDST1; -.
HGNC; HGNC:7680; NDST1.
HPA; HPA060532; -.
MalaCards; NDST1; -.
MIM; 600853; gene.
MIM; 616116; phenotype.
neXtProt; NX_P52848; -.
OpenTargets; ENSG00000070614; -.
Orphanet; 88616; Autosomal recessive non-syndromic intellectual disability.
PharmGKB; PA31486; -.
eggNOG; KOG3703; Eukaryota.
eggNOG; ENOG410XQN4; LUCA.
GeneTree; ENSGT00760000119023; -.
HOGENOM; HOG000008010; -.
HOVERGEN; HBG082011; -.
InParanoid; P52848; -.
KO; K02576; -.
OMA; TNTIDYH; -.
OrthoDB; EOG091G02CP; -.
PhylomeDB; P52848; -.
TreeFam; TF313193; -.
BioCyc; MetaCyc:HS01001-MONOMER; -.
Reactome; R-HSA-2022928; HS-GAG biosynthesis.
SABIO-RK; P52848; -.
UniPathway; UPA00756; -.
UniPathway; UPA00862; -.
ChiTaRS; NDST1; human.
EvolutionaryTrace; P52848; -.
GeneWiki; NDST1; -.
GenomeRNAi; 3340; -.
PRO; PR:P52848; -.
Proteomes; UP000005640; Chromosome 5.
Bgee; ENSG00000070614; -.
CleanEx; HS_NDST1; -.
ExpressionAtlas; P52848; baseline and differential.
Genevisible; P52848; HS.
GO; GO:0000139; C:Golgi membrane; TAS:Reactome.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0015016; F:[heparan sulfate]-glucosamine N-sulfotransferase activity; IDA:UniProtKB.
GO; GO:0042328; F:heparan sulfate N-acetylglucosaminyltransferase activity; IDA:UniProtKB.
GO; GO:0050119; F:N-acetylglucosamine deacetylase activity; TAS:Reactome.
GO; GO:0035904; P:aorta development; IEA:Ensembl.
GO; GO:0003279; P:cardiac septum development; IEA:Ensembl.
GO; GO:0060976; P:coronary vasculature development; IEA:Ensembl.
GO; GO:0048702; P:embryonic neurocranium morphogenesis; IEA:Ensembl.
GO; GO:0048703; P:embryonic viscerocranium morphogenesis; IEA:Ensembl.
GO; GO:0008543; P:fibroblast growth factor receptor signaling pathway; IEA:Ensembl.
GO; GO:0030900; P:forebrain development; IEA:Ensembl.
GO; GO:0006024; P:glycosaminoglycan biosynthetic process; TAS:Reactome.
GO; GO:0015012; P:heparan sulfate proteoglycan biosynthetic process; IDA:UniProtKB.
GO; GO:0015014; P:heparan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process; IDA:UniProtKB.
GO; GO:0030210; P:heparin biosynthetic process; IEA:UniProtKB-UniPathway.
GO; GO:0006954; P:inflammatory response; IEA:UniProtKB-KW.
GO; GO:0030901; P:midbrain development; IEA:Ensembl.
GO; GO:0043410; P:positive regulation of MAPK cascade; IEA:Ensembl.
GO; GO:0045880; P:positive regulation of smoothened signaling pathway; IEA:Ensembl.
GO; GO:0006477; P:protein sulfation; IEA:Ensembl.
GO; GO:0007585; P:respiratory gaseous exchange; IEA:Ensembl.
InterPro; IPR021930; Heparan_SO4_deacetylase.
InterPro; IPR037359; NST/OST.
InterPro; IPR027417; P-loop_NTPase.
InterPro; IPR000863; Sulfotransferase_dom.
PANTHER; PTHR10605; PTHR10605; 1.
Pfam; PF12062; HSNSD; 1.
Pfam; PF00685; Sulfotransfer_1; 1.
SUPFAM; SSF52540; SSF52540; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome;
Disease mutation; Disulfide bond; Glycoprotein; Golgi apparatus;
Hydrolase; Inflammatory response; Membrane; Mental retardation;
Multifunctional enzyme; Reference proteome; Signal-anchor;
Transferase; Transmembrane; Transmembrane helix.
CHAIN 1 882 Bifunctional heparan sulfate N-
deacetylase/N-sulfotransferase 1.
/FTId=PRO_0000085210.
TOPO_DOM 1 17 Cytoplasmic. {ECO:0000255}.
TRANSMEM 18 39 Helical; Signal-anchor for type II
membrane protein. {ECO:0000255}.
TOPO_DOM 40 882 Lumenal. {ECO:0000255}.
NP_BIND 614 618 PAPS. {ECO:0000269|PubMed:10196134}.
NP_BIND 833 837 PAPS. {ECO:0000269|PubMed:10196134}.
REGION 40 598 Heparan sulfate N-deacetylase 1.
REGION 599 882 Heparan sulfate N-sulfotransferase 1.
ACT_SITE 614 614 For sulfotransferase activity.
BINDING 712 712 PAPS. {ECO:0000269|PubMed:10196134}.
CARBOHYD 231 231 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 351 351 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 401 401 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 667 667 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 818 828 {ECO:0000269|PubMed:10196134}.
VAR_SEQ 523 556 ISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNL -> VSA
PQPMAAGEKGLLHSLSAADTGFLEPGKGGEA (in
isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_017397.
VAR_SEQ 557 882 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_017398.
VARIANT 611 611 G -> S (in MRT46; dbSNP:rs606231459).
{ECO:0000269|PubMed:25125150}.
/FTId=VAR_072646.
VARIANT 640 640 F -> L (in MRT46; dbSNP:rs606231458).
{ECO:0000269|PubMed:25125150}.
/FTId=VAR_072647.
VARIANT 642 642 E -> D (in MRT46; dbSNP:rs606231457).
{ECO:0000269|PubMed:25125150}.
/FTId=VAR_072648.
VARIANT 709 709 R -> Q (in MRT46; dbSNP:rs606231456).
{ECO:0000269|PubMed:25125150}.
/FTId=VAR_072649.
MUTAGEN 614 614 K->A: Loss of sulfotransferase activity.
{ECO:0000269|PubMed:9744796}.
CONFLICT 24 28 FIFCL -> QVVCQ (in Ref. 4; AAH12888).
{ECO:0000305}.
CONFLICT 60 60 P -> A (in Ref. 3; AAA67765).
{ECO:0000305}.
CONFLICT 364 364 H -> Q (in Ref. 4; AAH12888).
{ECO:0000305}.
CONFLICT 689 689 R -> G (in Ref. 3; AAA67765).
{ECO:0000305}.
CONFLICT 743 743 K -> R (in Ref. 3; AAA67765).
{ECO:0000305}.
STRAND 604 609 {ECO:0000244|PDB:1NST}.
HELIX 617 625 {ECO:0000244|PDB:1NST}.
STRAND 630 632 {ECO:0000244|PDB:1NST}.
TURN 637 639 {ECO:0000244|PDB:1NST}.
STRAND 646 648 {ECO:0000244|PDB:1NST}.
HELIX 649 653 {ECO:0000244|PDB:1NST}.
HELIX 655 659 {ECO:0000244|PDB:1NST}.
STRAND 672 676 {ECO:0000244|PDB:1NST}.
HELIX 679 682 {ECO:0000244|PDB:1NST}.
HELIX 686 693 {ECO:0000244|PDB:1NST}.
STRAND 698 703 {ECO:0000244|PDB:1NST}.
HELIX 706 719 {ECO:0000244|PDB:1NST}.
HELIX 723 727 {ECO:0000244|PDB:1NST}.
HELIX 730 734 {ECO:0000244|PDB:1NST}.
HELIX 742 752 {ECO:0000244|PDB:1NST}.
HELIX 753 755 {ECO:0000244|PDB:1NST}.
HELIX 757 765 {ECO:0000244|PDB:1NST}.
HELIX 770 772 {ECO:0000244|PDB:1NST}.
STRAND 773 777 {ECO:0000244|PDB:1NST}.
HELIX 778 783 {ECO:0000244|PDB:1NST}.
HELIX 785 796 {ECO:0000244|PDB:1NST}.
HELIX 805 807 {ECO:0000244|PDB:1NST}.
STRAND 808 811 {ECO:0000244|PDB:1NST}.
TURN 812 815 {ECO:0000244|PDB:1NST}.
STRAND 816 820 {ECO:0000244|PDB:1NST}.
HELIX 842 866 {ECO:0000244|PDB:1NST}.
HELIX 872 878 {ECO:0000244|PDB:1NST}.
SEQUENCE 882 AA; 100868 MW; D4B716B84A0BF4C4 CRC64;
MPALACLRRL CRHVSPQAVL FLLFIFCLFS VFISAYYLYG WKRGLEPSAD APEPDCGDPP
PVAPSRLLPL KPVQAATPSR TDPLVLVFVE SLYSQLGQEV VAILESSRFK YRTEIAPGKG
DMPTLTDKGR GRFALIIYEN ILKYVNLDAW NRELLDKYCV AYGVGIIGFF KANENSLLSA
QLKGFPLFLH SNLGLKDCSI NPKSPLLYVT RPSEVEKGVL PGEDWTVFQS NHSTYEPVLL
AKTRSSESIP HLGADAGLHA ALHATVVQDL GLHDGIQRVL FGNNLNFWLH KLVFVDAVAF
LTGKRLSLPL DRYILVDIDD IFVGKEGTRM KVEDVKALFD TQNELRAHIP NFTFNLGYSG
KFFHTGTNAE DAGDDLLLSY VKEFWWFPHM WSHMQPHLFH NQSVLAEQMA LNKKFAVEHG
IPTDMGYAVA PHHSGVYPVH VQLYEAWKQV WSIRVTSTEE YPHLKPARYR RGFIHNGIMV
LPRQTCGLFT HTIFYNEYPG GSSELDKIIN GGELFLTVLL NPISIFMTHL SNYGNDRLGL
YTFKHLVRFL HSWTNLRLQT LPPVQLAQKY FQIFSEEKDP LWQDPCEDKR HKDIWSKEKT
CDRFPKLLII GPQKTGTTAL YLFLGMHPDL SSNYPSSETF EEIQFFNGHN YHKGIDWYME
FFPIPSNTTS DFYFEKSANY FDSEVAPRRA AALLPKAKVL TILINPADRA YSWYQHQRAH
DDPVALKYTF HEVITAGSDA SSKLRALQNR CLVPGWYATH IERWLSAYHA NQILVLDGKL
LRTEPAKVMD MVQKFLGVTN TIDYHKTLAF DPKKGFWCQL LEGGKTKCLG KSKGRKYPEM
DLDSRAFLKD YYRDHNIELS KLLYKMGQTL PTWLREDLQN TR


Related products :

Catalog number Product name Quantity
EIAAB26681 [Heparan sulfate]-glucosamine N-sulfotransferase 1,Bifunctional heparan sulfate N-deacetylase_N-sulfotransferase 1,Glucosaminyl N-deacetylase_N-sulfotransferase 1,HSNST 1,Hsst,Hsst1,Ndanst,Ndst1,NDST-
EIAAB26683 [Heparan sulfate]-glucosamine N-sulfotransferase 1,Bifunctional heparan sulfate N-deacetylase_N-sulfotransferase 1,Glucosaminyl N-deacetylase_N-sulfotransferase 1,Homo sapiens,HSNST 1,HSST,HSST1,Human
EIAAB26682 [Heparan sulfate]-glucosamine N-sulfotransferase 1,Bifunctional heparan sulfate N-deacetylase_N-sulfotransferase 1,Glucosaminyl N-deacetylase_N-sulfotransferase 1,HSNST 1,Mouse,Mus musculus,Ndst1,NDST
EIAAB26685 Bifunctional heparan sulfate N-deacetylase_N-sulfotransferase 2,Glucosaminyl N-deacetylase_N-sulfotransferase 2,Homo sapiens,HSST2,Human,NDST2,NDST-2,N-heparan sulfate sulfotransferase 2,N-HSST 2
EIAAB26686 Bifunctional heparan sulfate N-deacetylase_N-sulfotransferase 2,Glucosaminyl N-deacetylase_N-sulfotransferase 2,Hsst2,Mndns,Mouse,Mus musculus,Ndst2,NDST-2,N-heparan sulfate sulfotransferase 2,N-HSST
EIAAB26690 Bifunctional heparan sulfate N-deacetylase_N-sulfotransferase 4,Glucosaminyl N-deacetylase_N-sulfotransferase 4,Homo sapiens,HSST4,Human,NDST4,NDST-4,N-heparan sulfate sulfotransferase 4,N-HSST 4
EIAAB26687 Bifunctional heparan sulfate N-deacetylase_N-sulfotransferase 3,Glucosaminyl N-deacetylase_N-sulfotransferase 3,Hsst3,Mouse,Mus musculus,Ndst3,NDST-3,N-heparan sulfate sulfotransferase 3,N-HSST 3
EIAAB26689 Bifunctional heparan sulfate N-deacetylase_N-sulfotransferase 4,Glucosaminyl N-deacetylase_N-sulfotransferase 4,Hsst4,Mouse,Mus musculus,Ndst4,NDST-4,N-heparan sulfate sulfotransferase 4,N-HSST 4
EIAAB26688 Bifunctional heparan sulfate N-deacetylase_N-sulfotransferase 3,Glucosaminyl N-deacetylase_N-sulfotransferase 3,hNDST-3,Homo sapiens,HSST3,Human,NDST3,NDST-3,N-heparan sulfate sulfotransferase 3,N-HSS
EIAAB26684 Bifunctional heparan sulfate N-deacetylase_N-sulfotransferase 2,Bos taurus,Bovine,CCL44,Glucosaminyl N-deacetylase_N-sulfotransferase 2,NDST2,NDST-2
EH2173 Bifunctional heparan sulfate N-deacetylase per N-sulfotransferase 2 Elisa Kit 96T
E15043r Human ELISA Kit FOR Bifunctional heparan sulfate N-deacetylase per N-sulfotransferase 1 96T
NDST4_HUMAN ELISA Kit FOR Bifunctional heparan sulfate N-deacetylase per N-sulfotransferase 4; organism: Human; gene name: NDST4 96T
NDST3_HUMAN ELISA Kit FOR Bifunctional heparan sulfate N-deacetylase per N-sulfotransferase 3; organism: Human; gene name: NDST3 96T
E2231h ELISA Kit FOR Bifunctional heparan sulfate N-deacetylase per N-sulfotransferase 2; organism: Human; gene name: NDST2 96T
E2231b ELISA Kit FOR Bifunctional heparan sulfate N-deacetylase per N-sulfotransferase 2; organism: Bovine; gene name: NDST2 96T
NDST1_HUMAN ELISA Kit FOR Bifunctional heparan sulfate N-deacetylase per N-sulfotransferase 1; organism: Human; gene name: NDST1 96T
HS6ST2 HS3ST6 Gene heparan sulfate (glucosamine) 3-O-sulfotransferase 6
HS3ST3A1 HS3ST1 Gene heparan sulfate (glucosamine) 3-O-sulfotransferase 1
HS3ST3B1 HS3ST2 Gene heparan sulfate (glucosamine) 3-O-sulfotransferase 2
HS3SA_HUMAN Human ELISA Kit FOR Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 96T
HS3ST4 HS3ST3A1 Gene heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
E0674b Human ELISA Kit FOR Heparan sulfate glucosamine 3-O-sulfotransferase 4 96T
PTHB1_HUMAN Human ELISA Kit FOR Heparan sulfate glucosamine 3-O-sulfotransferase 4 96T
HS3ST5 HS3ST3B1 Gene heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur