Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

C-C motif chemokine 25 (Chemokine TECK) (Small-inducible cytokine A25) (Thymus-expressed chemokine)

 CCL25_HUMAN             Reviewed;         150 AA.
O15444; A1L4J4; A6NI52; A8K9E7; B5MCA5; Q96KJ7;
15-JUL-1998, integrated into UniProtKB/Swiss-Prot.
22-JUL-2008, sequence version 2.
12-SEP-2018, entry version 144.
RecName: Full=C-C motif chemokine 25;
AltName: Full=Chemokine TECK;
AltName: Full=Small-inducible cytokine A25;
AltName: Full=Thymus-expressed chemokine;
Flags: Precursor;
Name=CCL25; Synonyms=SCYA25, TECK;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANT MET-104.
TISSUE=Thymus;
PubMed=9285413; DOI=10.1016/S1074-7613(00)80531-2;
Vicari A.P., Figueroa D.J., Hedrick J.A., Foster J.S., Singh K.P.,
Menon S., Copeland N.G., Gilbert D.J., Jenkins N.A., Bacon K.B.,
Zlotnik A.;
"TECK: a novel CC chemokine specifically expressed by thymic dendritic
cells and potentially involved in T cell development.";
Immunity 7:291-301(1997).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
TISSUE=Thymus;
Hieshima K., Nakayama T., Fujisawa R., Izawa D., Yoshie O.;
"Molecular cloning and characterization of a splicing variant of
chemokine TECK: a natural antagonist of human TECK.";
Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Thymus;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
TISSUE=Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
RECEPTOR INTERACTION.
PubMed=10229797;
Zaballos A., Gutierrez J., Varona R., Ardavin C., Marquez G.;
"Identification of the orphan chemokine receptor GPR-9-6 as CCR9, the
receptor for the chemokine TECK.";
J. Immunol. 162:5671-5675(1999).
[8]
RECEPTOR INTERACTION.
PubMed=23341447; DOI=10.1074/jbc.M112.406108;
Watts A.O., Verkaar F., van der Lee M.M., Timmerman C.A., Kuijer M.,
van Offenbeek J., van Lith L.H., Smit M.J., Leurs R., Zaman G.J.,
Vischer H.F.;
"Beta-arrestin recruitment and G protein signaling by the atypical
human chemokine decoy receptor CCX-CKR.";
J. Biol. Chem. 288:7169-7181(2013).
-!- FUNCTION: Potentially involved in T-cell development. Recombinant
protein shows chemotactic activity on thymocytes, macrophages,
THP-1 cells, and dendritics cells but is inactive on peripheral
blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an
antagonist of isoform 1. Binds to atypical chemokine receptor
ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to
ACKR4.
-!- INTERACTION:
Q92583:CCL17; NbExp=2; IntAct=EBI-7783341, EBI-16640146;
P13501:CCL5; NbExp=2; IntAct=EBI-7783341, EBI-2848366;
P48061:CXCL12; NbExp=2; IntAct=EBI-7783341, EBI-3913254;
P02776:PF4; NbExp=3; IntAct=EBI-7783341, EBI-2565740;
P10720:PF4V1; NbExp=2; IntAct=EBI-7783341, EBI-1223944;
-!- SUBCELLULAR LOCATION: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=O15444-1; Sequence=Displayed;
Name=2; Synonyms=TECKvar;
IsoId=O15444-2; Sequence=VSP_001064;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=3;
IsoId=O15444-3; Sequence=VSP_043199;
-!- TISSUE SPECIFICITY: Specifically expressed by thymic dendritic
cells. High levels in thymus and small intestine.
-!- SIMILARITY: Belongs to the intercrine beta (chemokine CC) family.
{ECO:0000305}.
-!- WEB RESOURCE: Name=Wikipedia; Note=CCL25 entry;
URL="https://en.wikipedia.org/wiki/CCL25";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; U86358; AAB69981.1; -; mRNA.
EMBL; AB046579; BAB62257.1; -; mRNA.
EMBL; AK292662; BAF85351.1; -; mRNA.
EMBL; AC008946; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471139; EAW68952.1; -; Genomic_DNA.
EMBL; BC130561; AAI30562.1; -; mRNA.
EMBL; BC144463; AAI44464.1; -; mRNA.
CCDS; CCDS12194.1; -. [O15444-1]
CCDS; CCDS56080.1; -. [O15444-3]
RefSeq; NP_001188288.1; NM_001201359.1. [O15444-3]
RefSeq; NP_005615.2; NM_005624.3. [O15444-1]
RefSeq; XP_011526479.1; XM_011528177.2. [O15444-1]
RefSeq; XP_016882609.1; XM_017027120.1. [O15444-1]
RefSeq; XP_016882610.1; XM_017027121.1. [O15444-1]
RefSeq; XP_016882611.1; XM_017027122.1. [O15444-3]
UniGene; Hs.310511; -.
ProteinModelPortal; O15444; -.
SMR; O15444; -.
BioGrid; 112273; 3.
DIP; DIP-5883N; -.
IntAct; O15444; 10.
MINT; O15444; -.
STRING; 9606.ENSP00000375086; -.
iPTMnet; O15444; -.
PhosphoSitePlus; O15444; -.
BioMuta; CCL25; -.
PaxDb; O15444; -.
PRIDE; O15444; -.
ProteomicsDB; 48672; -.
ProteomicsDB; 48673; -. [O15444-2]
ProteomicsDB; 48674; -. [O15444-3]
DNASU; 6370; -.
Ensembl; ENST00000253451; ENSP00000253451; ENSG00000131142. [O15444-3]
Ensembl; ENST00000390669; ENSP00000375086; ENSG00000131142. [O15444-1]
GeneID; 6370; -.
KEGG; hsa:6370; -.
UCSC; uc002mjc.5; human. [O15444-1]
CTD; 6370; -.
DisGeNET; 6370; -.
EuPathDB; HostDB:ENSG00000131142.13; -.
GeneCards; CCL25; -.
H-InvDB; HIX0039931; -.
HGNC; HGNC:10624; CCL25.
HPA; HPA055883; -.
MIM; 602565; gene.
neXtProt; NX_O15444; -.
OpenTargets; ENSG00000131142; -.
PharmGKB; PA35556; -.
eggNOG; ENOG410J09B; Eukaryota.
eggNOG; ENOG410Z7F2; LUCA.
GeneTree; ENSGT00900000141238; -.
HOGENOM; HOG000293281; -.
HOVERGEN; HBG050832; -.
InParanoid; O15444; -.
KO; K13072; -.
OMA; AWAPAVH; -.
PhylomeDB; O15444; -.
TreeFam; TF353160; -.
Reactome; R-HSA-380108; Chemokine receptors bind chemokines.
Reactome; R-HSA-418594; G alpha (i) signalling events.
SIGNOR; O15444; -.
GenomeRNAi; 6370; -.
PRO; PR:O15444; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000131142; Expressed in 59 organ(s), highest expression level in intestine.
CleanEx; HS_CCL25; -.
ExpressionAtlas; O15444; baseline and differential.
Genevisible; O15444; HS.
GO; GO:0005576; C:extracellular region; TAS:Reactome.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0031735; F:CCR10 chemokine receptor binding; IDA:BHF-UCL.
GO; GO:0008009; F:chemokine activity; IDA:UniProtKB.
GO; GO:0042379; F:chemokine receptor binding; IDA:UniProtKB.
GO; GO:0005179; F:hormone activity; TAS:ProtInc.
GO; GO:0061844; P:antimicrobial humoral immune response mediated by antimicrobial peptide; IDA:UniProtKB.
GO; GO:0060326; P:cell chemotaxis; IDA:UniProtKB.
GO; GO:0007166; P:cell surface receptor signaling pathway; TAS:ProtInc.
GO; GO:0071346; P:cellular response to interferon-gamma; IBA:GO_Central.
GO; GO:0071347; P:cellular response to interleukin-1; IBA:GO_Central.
GO; GO:0071356; P:cellular response to tumor necrosis factor; IBA:GO_Central.
GO; GO:0070098; P:chemokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0006935; P:chemotaxis; TAS:ProtInc.
GO; GO:0007186; P:G-protein coupled receptor signaling pathway; IDA:UniProtKB.
GO; GO:0006955; P:immune response; TAS:ProtInc.
GO; GO:0006954; P:inflammatory response; IBA:GO_Central.
GO; GO:0031640; P:killing of cells of other organism; IDA:UniProtKB.
GO; GO:0048247; P:lymphocyte chemotaxis; IBA:GO_Central.
GO; GO:0002548; P:monocyte chemotaxis; IBA:GO_Central.
GO; GO:1903237; P:negative regulation of leukocyte tethering or rolling; IDA:UniProtKB.
GO; GO:0030593; P:neutrophil chemotaxis; IBA:GO_Central.
GO; GO:0001954; P:positive regulation of cell-matrix adhesion; IDA:UniProtKB.
GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; IBA:GO_Central.
GO; GO:0043547; P:positive regulation of GTPase activity; IBA:GO_Central.
CDD; cd01119; Chemokine_CC_DCCL; 1.
InterPro; IPR034133; Chemokine_CC_DCCL.
InterPro; IPR001811; Chemokine_IL8-like_dom.
InterPro; IPR036048; Interleukin_8-like_sf.
Pfam; PF00048; IL8; 1.
SMART; SM00199; SCY; 1.
SUPFAM; SSF54117; SSF54117; 1.
1: Evidence at protein level;
Alternative splicing; Chemotaxis; Complete proteome; Cytokine;
Disulfide bond; Inflammatory response; Polymorphism;
Reference proteome; Secreted; Signal.
SIGNAL 1 23 {ECO:0000255}.
CHAIN 24 150 C-C motif chemokine 25.
/FTId=PRO_0000005235.
DISULFID 30 58 {ECO:0000250}.
DISULFID 31 75 {ECO:0000250}.
VAR_SEQ 65 150 FYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQ
TFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISA
NSGL -> RPSCCKEVEFWKLQVIIIQV (in isoform
2). {ECO:0000303|Ref.2}.
/FTId=VSP_001064.
VAR_SEQ 109 109 Missing (in isoform 3).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_043199.
VARIANT 23 23 T -> A (in dbSNP:rs960173).
/FTId=VAR_044519.
VARIANT 101 101 H -> R (in dbSNP:rs2032887).
/FTId=VAR_044520.
VARIANT 104 104 T -> M (in dbSNP:rs1129763).
{ECO:0000269|PubMed:9285413}.
/FTId=VAR_044521.
SEQUENCE 150 AA; 16609 MW; 91D0810F137FBC7B CRC64;
MNLWLLACLV AGFLGAWAPA VHTQGVFEDC CLAYHYPIGW AVLRRAWTYR IQEVSGSCNL
PAAIFYLPKR HRKVCGNPKS REVQRAMKLL DARNKVFAKL HHNTQTFQAG PHAVKKLSSG
NSKLSSSKFS NPISSSKRNV SLLISANSGL


Related products :

Catalog number Product name Quantity
E1248m ELISA kit C-C motif chemokine 25,Ccl25,Chemokine TECK,Mouse,Mus musculus,Scya25,Small-inducible cytokine A25,Teck,Thymus-expressed chemokine 96T
E1248m ELISA C-C motif chemokine 25,Ccl25,Chemokine TECK,Mouse,Mus musculus,Scya25,Small-inducible cytokine A25,Teck,Thymus-expressed chemokine 96T
U1248m CLIA C-C motif chemokine 25,Ccl25,Chemokine TECK,Mouse,Mus musculus,Scya25,Small-inducible cytokine A25,Teck,Thymus-expressed chemokine 96T
U1248h CLIA C-C motif chemokine 25,CCL25,Chemokine TECK,Homo sapiens,Human,SCYA25,Small-inducible cytokine A25,TECK,Thymus-expressed chemokine 96T
E1248h ELISA C-C motif chemokine 25,CCL25,Chemokine TECK,Homo sapiens,Human,SCYA25,Small-inducible cytokine A25,TECK,Thymus-expressed chemokine 96T
E1248h ELISA kit C-C motif chemokine 25,CCL25,Chemokine TECK,Homo sapiens,Human,SCYA25,Small-inducible cytokine A25,TECK,Thymus-expressed chemokine 96T
U1607m CLIA B-cell and monocyte-activating chemokine,Bmac,Chemokine BRAK,C-X-C motif chemokine 14,Cxcl14,Kec,Kidney-expressed chemokine CXC,Ks1,Mip2g,MIP-2G,Mouse,Mus musculus,Scyb14,Small-inducible cytokine 96T
15-288-21084 Small inducible cytokine A16 - CCL16; IL-10-inducible chemokine; Chemokine LEC; Liver-expressed chemokine; Monotactin-1; MTN-1; Chemokine CC-4; HCC-4; NCC-4; Lymphocyte and monocyte chemoattractant; L 0.1 mg
15-288-21084 Small inducible cytokine A16 - CCL16; IL-10-inducible chemokine; Chemokine LEC; Liver-expressed chemokine; Monotactin-1; MTN-1; Chemokine CC-4; HCC-4; NCC-4; Lymphocyte and monocyte chemoattractant; L 0.05 mg
U1571h CLIA CC chemokine TARC,C-C motif chemokine 17,CCL17,Homo sapiens,Human,SCYA17,Small-inducible cytokine A17,TARC,Thymus and activation-regulated chemokine 96T
E1571h ELISA kit CC chemokine TARC,C-C motif chemokine 17,CCL17,Homo sapiens,Human,SCYA17,Small-inducible cytokine A17,TARC,Thymus and activation-regulated chemokine 96T
E1571h ELISA CC chemokine TARC,C-C motif chemokine 17,CCL17,Homo sapiens,Human,SCYA17,Small-inducible cytokine A17,TARC,Thymus and activation-regulated chemokine 96T
E1607m ELISA kit B-cell and monocyte-activating chemokine,Bmac,Chemokine BRAK,C-X-C motif chemokine 14,Cxcl14,Kec,Kidney-expressed chemokine CXC,Ks1,Mip2g,MIP-2G,Mouse,Mus musculus,Scyb14,Small-inducible cy 96T
E1607m ELISA B-cell and monocyte-activating chemokine,Bmac,Chemokine BRAK,C-X-C motif chemokine 14,Cxcl14,Kec,Kidney-expressed chemokine CXC,Ks1,Mip2g,MIP-2G,Mouse,Mus musculus,Scyb14,Small-inducible cytokin 96T
E1651h ELISA CC chemokine ILC,C-C motif chemokine 27,CCL27,CTACK,Cutaneous T-cell-attracting chemokine,ESkine,Homo sapiens,Human,IL-11 R-alpha-locus chemokine,ILC,SCYA27,Skinkine,Small-inducible cytokine A27 96T
U1651h CLIA CC chemokine ILC,C-C motif chemokine 27,CCL27,CTACK,Cutaneous T-cell-attracting chemokine,ESkine,Homo sapiens,Human,IL-11 R-alpha-locus chemokine,ILC,SCYA27,Skinkine,Small-inducible cytokine A27 96T
E0138h ELISA C-C motif chemokine 16,CCL16,Chemokine CC-4,Chemokine LEC,HCC-4,Homo sapiens,Human,IL-10-inducible chemokine,ILINCK,LCC-1,Liver-expressed chemokine,LMC,Lymphocyte and monocyte chemoattractant,Mo 96T
U0138h CLIA C-C motif chemokine 16,CCL16,Chemokine CC-4,Chemokine LEC,HCC-4,Homo sapiens,Human,IL-10-inducible chemokine,ILINCK,LCC-1,Liver-expressed chemokine,LMC,Lymphocyte and monocyte chemoattractant,Mon 96T
E0138h ELISA kit C-C motif chemokine 16,CCL16,Chemokine CC-4,Chemokine LEC,HCC-4,Homo sapiens,Human,IL-10-inducible chemokine,ILINCK,LCC-1,Liver-expressed chemokine,LMC,Lymphocyte and monocyte chemoattracta 96T
EIAAB05843 6Ckine,Beta-chemokine exodus-2,C-C motif chemokine 21c,Ccl21c,Mouse,Mus musculus,Scya21c,Small-inducible cytokine A21c,TCA4,Thymus-derived chemotactic agent 4
EIAAB05842 6Ckine,Beta-chemokine exodus-2,C-C motif chemokine 21b,Ccl21b,Mouse,Mus musculus,Scya21,Scya21b,Small-inducible cytokine A21b,TCA4,Thymus-derived chemotactic agent 4
E1571c ELISA Canis familiaris,Canis lupus familiaris,CC chemokine TARC,C-C motif chemokine 17,CCL17,Dog,Small-inducible cytokine A17,TARC,Thymus and activation-regulated chemokine 96T
E1571c ELISA kit Canis familiaris,Canis lupus familiaris,CC chemokine TARC,C-C motif chemokine 17,CCL17,Dog,Small-inducible cytokine A17,TARC,Thymus and activation-regulated chemokine 96T
U1571c CLIA Canis familiaris,Canis lupus familiaris,CC chemokine TARC,C-C motif chemokine 17,CCL17,Dog,Small-inducible cytokine A17,TARC,Thymus and activation-regulated chemokine 96T
U1575m CLIA 6Ckine,Beta-chemokine exodus-2,C-C motif chemokine 21a,Ccl21a,Mouse,Mus musculus,Scya21,Scya21a,Small-inducible cytokine A21a,TCA4,Thymus-derived chemotactic agent 4 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur