Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

C-C motif chemokine 4-like (Lymphocyte activation gene 1 protein) (LAG-1) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (Monocyte adherence-induced protein 5-alpha) (Small-inducible cytokine A4-like)

 CC4L_HUMAN              Reviewed;          92 AA.
Q8NHW4; B2RUZ3; B7ZMA8; Q50EM1; Q50EM2; Q50EM3; Q50EM4; Q50EM5;
Q50EM6; Q50EM7; Q50EM8; Q569J2; Q6NSB0;
18-MAR-2008, integrated into UniProtKB/Swiss-Prot.
01-OCT-2002, sequence version 1.
12-SEP-2018, entry version 133.
RecName: Full=C-C motif chemokine 4-like;
AltName: Full=Lymphocyte activation gene 1 protein;
Short=LAG-1;
AltName: Full=Macrophage inflammatory protein 1-beta;
Short=MIP-1-beta;
AltName: Full=Monocyte adherence-induced protein 5-alpha;
AltName: Full=Small-inducible cytokine A4-like;
Flags: Precursor;
Name=CCL4L1; Synonyms=CCL4L, LAG1, SCYA4L1;
and
Name=CCL4L2; Synonyms=CCL4L, SCYA4L2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
Nibbs R.J., Barcellos L.F., Townson J.R.;
"Variation in gene copy number of the human chemokines macrophage
inflammatory protein-1a/CCL3 and macrophage inflammatory protein-
1b/CCL4.";
Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6;
7; 8; 9 AND 10).
PubMed=15843566; DOI=10.4049/jimmunol.174.9.5655;
Colobran R., Adreani P., Ashhab Y., Llano A., Este J.A., Dominguez O.,
Pujol-Borrell R., Juan M.;
"Multiple products derived from two CCL4 loci: high incidence of a new
polymorphism in HIV+ patients.";
J. Immunol. 174:5655-5664(2005).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
TISSUE=Blood, and Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
IDENTIFICATION.
PubMed=11685466; DOI=10.1007/s002510100366;
Modi W.S., Bergeron J., Sanford M.;
"The human MIP-1beta chemokine is encoded by two paralogous genes,
ACT-2 and LAG-1.";
Immunogenetics 53:543-549(2001).
[5]
FUNCTION, INTERACTION WITH CCR5, AND GENOMIC DUPLICATION.
PubMed=15240137; DOI=10.1016/j.bbrc.2004.06.039;
Howard O.M.Z., Turpin J.A., Goldman R., Modi W.S.;
"Functional redundancy of the human CCL4 and CCL4L1 chemokine genes.";
Biochem. Biophys. Res. Commun. 320:927-931(2004).
[6]
IDENTIFICATION, AND GENOMIC DUPLICATION.
PubMed=15028295; DOI=10.1016/j.ygeno.2003.09.019;
Modi W.S.;
"CCL3L1 and CCL4L1 chemokine genes are located in a segmental
duplication at chromosome 17q12.";
Genomics 83:735-738(2004).
[7]
TISSUE SPECIFICITY.
PubMed=14673550; DOI=10.1007/s00251-003-0636-z;
Lu J., Honczarenko M., Sloan S.R.;
"Independent expression of the two paralogous CCL4 genes in monocytes
and B lymphocytes.";
Immunogenetics 55:706-711(2004).
[8]
IDENTIFICATION, AND POLYMORPHISM OF GENE COPY NUMBER.
PubMed=17330138; DOI=10.1038/sj.gene.6364378;
Shao W., Tang J., Song W., Wang C., Li Y., Wilson C.M., Kaslow R.A.;
"CCL3L1 and CCL4L1: variable gene copy number in adolescents with and
without human immunodeficiency virus type 1 (HIV-1) infection.";
Genes Immun. 8:224-231(2007).
-!- FUNCTION: Chemokine that induces chemotaxis of cells expressing
CCR5 or CCR1. Inhibits HIV replication in peripheral blood
monocytes that express CCR5. {ECO:0000269|PubMed:15240137}.
-!- SUBUNIT: Interacts with CCR5. {ECO:0000269|PubMed:15240137}.
-!- INTERACTION:
Q9BRI3:SLC30A2; NbExp=3; IntAct=EBI-10271156, EBI-8644112;
-!- SUBCELLULAR LOCATION: Secreted {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=10;
Comment=CCL4L1 and CCL4L2 genes differ in their non-coding
regions. Thus, alternative splicing events differ between the
two genes.;
Name=1;
IsoId=Q8NHW4-1; Sequence=Displayed;
Name=2; Synonyms=CCL4L2;
IsoId=Q8NHW4-2; Sequence=VSP_032633;
Name=3; Synonyms=CC4L2d;
IsoId=Q8NHW4-3; Sequence=VSP_032629;
Name=4; Synonyms=CC4L2f;
IsoId=Q8NHW4-4; Sequence=VSP_032630;
Name=5; Synonyms=CC4L2b1, CC4L2b2;
IsoId=Q8NHW4-5; Sequence=VSP_032631;
Name=6; Synonyms=CC4L2e;
IsoId=Q8NHW4-6; Sequence=VSP_032632;
Name=7; Synonyms=CC4L2d2;
IsoId=Q8NHW4-7; Sequence=VSP_032625;
Name=8; Synonyms=CC4L1d2;
IsoId=Q8NHW4-8; Sequence=VSP_032626;
Name=9; Synonyms=CC4L2bd2;
IsoId=Q8NHW4-9; Sequence=VSP_032627;
Name=10; Synonyms=CC44L2c;
IsoId=Q8NHW4-10; Sequence=VSP_032628;
-!- TISSUE SPECIFICITY: Detected in B-cells.
{ECO:0000269|PubMed:14673550}.
-!- POLYMORPHISM: The copy number of the CC4L1 gene varies among
individuals; most individuals have 1 to 6 copies in the diploid
genome. {ECO:0000269|PubMed:17330138}.
-!- SIMILARITY: Belongs to the intercrine beta (chemokine CC) family.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AY079147; AAL87008.1; -; Genomic_DNA.
EMBL; AY766460; AAX07294.1; -; Genomic_DNA.
EMBL; AY766460; AAX07295.1; -; Genomic_DNA.
EMBL; AY766461; AAX07296.1; -; Genomic_DNA.
EMBL; AY766461; AAX07297.1; -; Genomic_DNA.
EMBL; AY766461; AAX07298.1; -; Genomic_DNA.
EMBL; AY766461; AAX07299.1; -; Genomic_DNA.
EMBL; AY766461; AAX07300.1; -; Genomic_DNA.
EMBL; AY766461; AAX07301.1; -; Genomic_DNA.
EMBL; AY766461; AAX07302.1; -; Genomic_DNA.
EMBL; AY766461; AAX07303.1; -; Genomic_DNA.
EMBL; AY766461; AAX07304.1; -; Genomic_DNA.
EMBL; AY766447; AAX07306.1; -; mRNA.
EMBL; AY766449; AAX07308.1; -; mRNA.
EMBL; AY766450; AAX07309.1; -; mRNA.
EMBL; AY766451; AAX07310.1; -; mRNA.
EMBL; AY766452; AAX07311.1; -; mRNA.
EMBL; AY766453; AAX07312.1; -; mRNA.
EMBL; AY766454; AAX07313.1; -; mRNA.
EMBL; AY766455; AAX07314.1; -; mRNA.
EMBL; AY766456; AAX07315.1; -; mRNA.
EMBL; AY766457; AAX07316.1; -; mRNA.
EMBL; AY766458; AAX07317.1; -; mRNA.
EMBL; BC070310; AAH70310.1; -; mRNA.
EMBL; BC092445; AAH92445.1; -; mRNA.
EMBL; BC130456; AAI30457.1; -; mRNA.
EMBL; BC130458; AAI30459.1; -; mRNA.
EMBL; BC144393; AAI44394.1; -; mRNA.
EMBL; BC144394; AAI44395.1; -; mRNA.
EMBL; BC171864; AAI71864.1; -; mRNA.
EMBL; BC146944; AAI46945.1; -; mRNA.
EMBL; BC146958; AAI46959.1; -; mRNA.
PIR; C60407; C60407.
RefSeq; NP_001278397.1; NM_001291468.1. [Q8NHW4-2]
RefSeq; NP_001278398.1; NM_001291469.1. [Q8NHW4-5]
RefSeq; NP_001278399.1; NM_001291470.1. [Q8NHW4-5]
RefSeq; NP_001278400.1; NM_001291471.1. [Q8NHW4-10]
RefSeq; NP_001278401.1; NM_001291472.1. [Q8NHW4-3]
RefSeq; NP_001278402.1; NM_001291473.1. [Q8NHW4-6]
RefSeq; NP_001278403.1; NM_001291474.1. [Q8NHW4-9]
RefSeq; NP_001278404.1; NM_001291475.1. [Q8NHW4-4]
RefSeq; NP_996890.1; NM_207007.3. [Q8NHW4-1]
UniGene; Hs.449862; -.
UniGene; Hs.515183; -.
ProteinModelPortal; Q8NHW4; -.
SMR; Q8NHW4; -.
BioGrid; 114931; 1.
IntAct; Q8NHW4; 54.
STRING; 9606.ENSP00000405533; -.
DMDM; 74727347; -.
PaxDb; Q8NHW4; -.
PeptideAtlas; Q8NHW4; -.
PRIDE; Q8NHW4; -.
ProteomicsDB; 73769; -.
ProteomicsDB; 73770; -. [Q8NHW4-10]
ProteomicsDB; 73771; -. [Q8NHW4-2]
ProteomicsDB; 73772; -. [Q8NHW4-3]
ProteomicsDB; 73773; -. [Q8NHW4-4]
ProteomicsDB; 73774; -. [Q8NHW4-5]
ProteomicsDB; 73775; -. [Q8NHW4-6]
ProteomicsDB; 73776; -. [Q8NHW4-7]
ProteomicsDB; 73777; -. [Q8NHW4-8]
ProteomicsDB; 73778; -. [Q8NHW4-9]
TopDownProteomics; Q8NHW4-4; -. [Q8NHW4-4]
DNASU; 388372; -.
DNASU; 9560; -.
Ensembl; ENST00000610565; ENSP00000484498; ENSG00000276070. [Q8NHW4-6]
Ensembl; ENST00000613173; ENSP00000484455; ENSG00000276070. [Q8NHW4-9]
Ensembl; ENST00000615418; ENSP00000483206; ENSG00000276070. [Q8NHW4-3]
Ensembl; ENST00000617405; ENSP00000483330; ENSG00000276070. [Q8NHW4-4]
Ensembl; ENST00000617416; ENSP00000480089; ENSG00000276070. [Q8NHW4-5]
Ensembl; ENST00000620055; ENSP00000481323; ENSG00000276070. [Q8NHW4-7]
Ensembl; ENST00000620098; ENSP00000479774; ENSG00000276070. [Q8NHW4-10]
Ensembl; ENST00000620250; ENSP00000483609; ENSG00000276070. [Q8NHW4-1]
Ensembl; ENST00000620576; ENSP00000479354; ENSG00000276070. [Q8NHW4-2]
Ensembl; ENST00000620708; ENSP00000479126; ENSG00000275313. [Q8NHW4-1]
Ensembl; ENST00000620732; ENSP00000481969; ENSG00000276070. [Q8NHW4-5]
Ensembl; ENST00000631660; ENSP00000488687; ENSG00000275313. [Q8NHW4-7]
Ensembl; ENST00000632416; ENSP00000487859; ENSG00000275313. [Q8NHW4-2]
Ensembl; ENST00000632710; ENSP00000488758; ENSG00000275313. [Q8NHW4-5]
Ensembl; ENST00000634078; ENSP00000488231; ENSG00000275313. [Q8NHW4-6]
GeneID; 388372; -.
GeneID; 9560; -.
KEGG; hsa:388372; -.
KEGG; hsa:9560; -.
UCSC; uc002hlh.2; human. [Q8NHW4-1]
CTD; 388372; -.
CTD; 9560; -.
DisGeNET; 388372; -.
DisGeNET; 6351; -.
DisGeNET; 9560; -.
EuPathDB; HostDB:ENSG00000276070.4; -.
GeneCards; CCL4L1; -.
GeneCards; CCL4L2; -.
HGNC; HGNC:10631; CCL4L1.
HGNC; HGNC:24066; CCL4L2.
MIM; 603782; gene.
MIM; 610757; gene.
neXtProt; NX_Q8NHW4; -.
OpenTargets; ENSG00000276070; -.
PharmGKB; PA35563; -.
eggNOG; ENOG410J4I9; Eukaryota.
eggNOG; ENOG410YXJU; LUCA.
GeneTree; ENSGT00900000140870; -.
HOVERGEN; HBG017871; -.
InParanoid; Q8NHW4; -.
KO; K12964; -.
OMA; WVQEYVD; -.
OrthoDB; EOG091G14Y2; -.
PhylomeDB; Q8NHW4; -.
TreeFam; TF334888; -.
Reactome; R-HSA-418594; G alpha (i) signalling events.
SIGNOR; Q8NHW4; -.
PRO; PR:Q8NHW4; -.
Proteomes; UP000005640; Chromosome 17.
Bgee; ENSG00000276070; Expressed in 87 organ(s), highest expression level in leukocyte.
CleanEx; HS_CCL4L1; -.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0048020; F:CCR chemokine receptor binding; IBA:GO_Central.
GO; GO:0008009; F:chemokine activity; IBA:GO_Central.
GO; GO:0071346; P:cellular response to interferon-gamma; IBA:GO_Central.
GO; GO:0071347; P:cellular response to interleukin-1; IBA:GO_Central.
GO; GO:0071356; P:cellular response to tumor necrosis factor; IBA:GO_Central.
GO; GO:0070098; P:chemokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0007186; P:G-protein coupled receptor signaling pathway; IBA:GO_Central.
GO; GO:0006954; P:inflammatory response; IBA:GO_Central.
GO; GO:0048247; P:lymphocyte chemotaxis; IBA:GO_Central.
GO; GO:0002548; P:monocyte chemotaxis; IBA:GO_Central.
GO; GO:0030593; P:neutrophil chemotaxis; IBA:GO_Central.
GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; IBA:GO_Central.
GO; GO:0043547; P:positive regulation of GTPase activity; IBA:GO_Central.
InterPro; IPR000827; Chemokine_CC_CS.
InterPro; IPR001811; Chemokine_IL8-like_dom.
InterPro; IPR036048; Interleukin_8-like_sf.
Pfam; PF00048; IL8; 1.
SMART; SM00199; SCY; 1.
SUPFAM; SSF54117; SSF54117; 1.
PROSITE; PS00472; SMALL_CYTOKINES_CC; 1.
1: Evidence at protein level;
Alternative splicing; Chemotaxis; Complete proteome; Cytokine;
Disulfide bond; Inflammatory response; Reference proteome; Secreted;
Signal.
SIGNAL 1 23 {ECO:0000250}.
CHAIN 24 92 C-C motif chemokine 4-like.
/FTId=PRO_0000326234.
DISULFID 34 58 {ECO:0000250}.
DISULFID 35 74 {ECO:0000250}.
VAR_SEQ 26 92 MGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQ
TKRGKQVCADPSESWVQEYVYDLELN -> KASKSALTPVS
PGSRSTCMTWN (in isoform 7).
{ECO:0000303|PubMed:15843566}.
/FTId=VSP_032625.
VAR_SEQ 26 92 MGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQ
TKRGKQVCADPSESWVQEYVYDLELN -> NSKPKEASKSA
LTPVSPGSRSTCMTWN (in isoform 8).
{ECO:0000303|PubMed:15843566}.
/FTId=VSP_032626.
VAR_SEQ 26 92 MGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQ
TKRGKQVCADPSESWVQEYVYDLELN -> TKSSEWKLQGV
CFQCCSGKDPIHQSCPTWTMVRQRKMPTTGKG (in
isoform 9).
{ECO:0000303|PubMed:15843566}.
/FTId=VSP_032627.
VAR_SEQ 65 92 FQTKRGKQVCADPSESWVQEYVYDLELN -> YRESASSAA
PGRIPSTRAAPHGPWSGRGRCLPQARDKAR (in
isoform 10).
{ECO:0000303|PubMed:15843566}.
/FTId=VSP_032628.
VAR_SEQ 65 92 FQTKRGKQVCADPSESWVQEYVYDLELN -> AAPGRIPST
RAAPHGPWSGRGRCLPQARDKAR (in isoform 3).
{ECO:0000303|PubMed:15843566}.
/FTId=VSP_032629.
VAR_SEQ 65 92 FQTKRGKQVCADPSESWVQEYVYDLELN -> EWKLQGVCF
QCCSGKDPIHQSCPTWTMVRQRKMPTTGKG (in
isoform 4).
{ECO:0000303|PubMed:15843566}.
/FTId=VSP_032630.
VAR_SEQ 65 92 Missing (in isoform 5).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:15843566}.
/FTId=VSP_032631.
VAR_SEQ 65 92 FQTKRGKQVCADPSESWVQEYVYDLELN -> AAPHGPWSG
RGRCLPQARDKAR (in isoform 6).
{ECO:0000303|PubMed:15843566}.
/FTId=VSP_032632.
VAR_SEQ 65 69 Missing (in isoform 2).
{ECO:0000303|PubMed:15843566}.
/FTId=VSP_032633.
CONFLICT 45 45 R -> H (in Ref. 3; AAH70310).
{ECO:0000305}.
SEQUENCE 92 AA; 10166 MW; 4C8D01E926CDE882 CRC64;
MKLCVTVLSL LVLVAAFCSL ALSAPMGSDP PTACCFSYTA RKLPRNFVVD YYETSSLCSQ
PAVVFQTKRG KQVCADPSES WVQEYVYDLE LN


Related products :

Catalog number Product name Quantity
EIAAB05849 C-C motif chemokine 4-like,CCL4L,CCL4L1,Homo sapiens,Human,LAG1,LAG-1,Lymphocyte activation gene 1 protein,Macrophage inflammatory protein 1-beta,MIP-1-beta,Monocyte adherence-induced protein 5-alpha,
15-288-21035 Small inducible cytokine A4 - CCL4; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); T-cell activation protein 2; ACT-2; PAT 744; H400; SIS-gamma; Lymphocyte activation gene 1 pro 0.1 mg
15-288-21035 Small inducible cytokine A4 - CCL4; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); T-cell activation protein 2; ACT-2; PAT 744; H400; SIS-gamma; Lymphocyte activation gene 1 pro 0.05 mg
E0093m ELISA ACT2,ACT-2,C-C motif chemokine 4,Ccl4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Mouse,Mus musculus,Protein H400,Scya4,SIS-gamma,Small-inducible cytokine 96T
U0093m CLIA ACT2,ACT-2,C-C motif chemokine 4,Ccl4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Mouse,Mus musculus,Protein H400,Scya4,SIS-gamma,Small-inducible cytokine 96T
U0093Rb CLIA ACT-2,C-C motif chemokine 4,CCL4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,MIP-1-beta,Oryctolagus cuniculus,Rabbit,SCYA4,Small-inducible cytokine A4 96T
E0093Rb ELISA kit ACT-2,C-C motif chemokine 4,CCL4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,MIP-1-beta,Oryctolagus cuniculus,Rabbit,SCYA4,Small-inducible cytokine A4 96T
E0093Rb ELISA ACT-2,C-C motif chemokine 4,CCL4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,MIP-1-beta,Oryctolagus cuniculus,Rabbit,SCYA4,Small-inducible cytokine A4 96T
U0093h CLIA ACT-2,C-C motif chemokine 4,CCL4,G-26 T-lymphocyte-secreted protein,HC21,Homo sapiens,Human,LAG1,LAG-1,Lymphocyte activation gene 1 protein,Macrophage inflammatory protein 1-beta,MIP1B,MIP-1-beta 96T
18-783-75647 RABBIT ANTI HUMAN MIP-3 ALPHA - CCL20; Small-inducible cytokine A20; Macrophage inflammatory protein 3 alpha; MIP-3-alpha; Liver and activation-regulated chemokine; CC chemokine LARC; Beta chemokine e 0.1 mg
E0093m ELISA kit ACT2,ACT-2,C-C motif chemokine 4,Ccl4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Mouse,Mus musculus,Protein H400,Scya4,SIS-gamma,Small-inducible cyt 96T
18-783-78922 RABBIT ANTI HUMAN MIP-3 ALPHA Biotin - CCL20; Small-inducible cytokine A20; Macrophage inflammatory protein 3 alpha; MIP-3-alpha; Liver and activation-regulated chemokine; CC chemokine LARC; Beta chem 0.05 mg
18-783-78972 RABBIT ANTI HUMAN MIP-1 BETA - CCL4; Small-inducible cytokine A4; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); T-cell activation protein 2; ACT-2; PAT 744; Protein H400; SIS-g 0.1 mg
10-783-79047 RECOMBINANT HUMAN MIP-1 BETA - CCL4; Small-inducible cytokine A4; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); T-cell activation protein 2; ACT-2; PAT 744; Protein H400; SIS-g 0.01 mg
18-783-78899 RABBIT ANTI HUMAN MIP-1 BETA Biotin - CCL4; Small-inducible cytokine A4; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); T-cell activation protein 2; ACT-2; PAT 744; Protein H400 0.05 mg
E0093p ELISA C-C motif chemokine 4,CCL4,Macrophage inflammatory protein 1-beta,MIP1B,MIP-1-beta,Pig,SCY4A,Small-inducible cytokine A4,Sus scrofa 96T
U0093p CLIA C-C motif chemokine 4,CCL4,Macrophage inflammatory protein 1-beta,MIP1B,MIP-1-beta,Pig,SCY4A,Small-inducible cytokine A4,Sus scrofa 96T
E0093p ELISA kit C-C motif chemokine 4,CCL4,Macrophage inflammatory protein 1-beta,MIP1B,MIP-1-beta,Pig,SCY4A,Small-inducible cytokine A4,Sus scrofa 96T
E0093h ELISA kit ACT-2,C-C motif chemokine 4,CCL4,G-26 T-lymphocyte-secreted protein,HC21,Homo sapiens,Human,LAG1,LAG-1,Lymphocyte activation gene 1 protein,Macrophage inflammatory protein 1-beta,MIP1B,MIP- 96T
E0093h ELISA ACT-2,C-C motif chemokine 4,CCL4,G-26 T-lymphocyte-secreted protein,HC21,Homo sapiens,Human,LAG1,LAG-1,Lymphocyte activation gene 1 protein,Macrophage inflammatory protein 1-beta,MIP1B,MIP-1-bet 96T
E0093r ELISA C-C motif chemokine 4,Ccl4,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Rat,Rattus norvegicus,Scya4,Small-inducible cytokine A4 96T
U0093r CLIA C-C motif chemokine 4,Ccl4,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Rat,Rattus norvegicus,Scya4,Small-inducible cytokine A4 96T
E0093r ELISA kit C-C motif chemokine 4,Ccl4,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Rat,Rattus norvegicus,Scya4,Small-inducible cytokine A4 96T
18-783-75648 RABBIT ANTI HUMAN MIP-3 BETA - CCL19; Small-inducible cytokine A19; Macrophage inflammatory protein 3 beta; MIP-3-beta; EBI1-ligand chemokine; ELC; Beta chemokine exodus-3; CK beta-11 Polyclonal 0.1 mg
18-783-78923 RABBIT ANTI HUMAN MIP-3 BETA Biotin - CCL19; Small-inducible cytokine A19; Macrophage inflammatory protein 3 beta; MIP-3-beta; EBI1-ligand chemokine; ELC; Beta chemokine exodus-3; CK beta-11 Polyclona 0.05 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur