Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

C-Jun-amino-terminal kinase-interacting protein 2 (JIP-2) (JNK-interacting protein 2) (Islet-brain-2) (IB-2) (JNK MAP kinase scaffold protein 2) (Mitogen-activated protein kinase 8-interacting protein 2)

 JIP2_HUMAN              Reviewed;         824 AA.
Q13387; Q96G62; Q99771; Q9NZ59; Q9UKQ4;
05-DEC-2001, integrated into UniProtKB/Swiss-Prot.
05-DEC-2001, sequence version 2.
18-JUL-2018, entry version 162.
RecName: Full=C-Jun-amino-terminal kinase-interacting protein 2;
Short=JIP-2;
Short=JNK-interacting protein 2;
AltName: Full=Islet-brain-2;
Short=IB-2;
AltName: Full=JNK MAP kinase scaffold protein 2;
AltName: Full=Mitogen-activated protein kinase 8-interacting protein 2;
Name=MAPK8IP2; Synonyms=IB2, JIP2, PRKM8IPL;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH JNK1; JNK2;
JNK3; MAP2K7; MAP3K10; MAP3K11 AND MAP3K12, AND SUBCELLULAR LOCATION.
TISSUE=Brain;
PubMed=10490659; DOI=10.1128/MCB.19.10.7245;
Yasuda J., Whitmarsh A.J., Cavanagh J., Sharma M., Davis R.J.;
"The JIP group of mitogen-activated protein kinase scaffold
proteins.";
Mol. Cell. Biol. 19:7245-7254(1999).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
TISSUE=Brain, and Insulinoma;
PubMed=10756100; DOI=10.1006/geno.2000.6129;
Negri S., Oberson A., Steinmann M., Sauser C., Nicod P., Waeber G.,
Schorderet D.F., Bonny C.;
"cDNA cloning and mapping of a novel islet-brain/JNK interacting
protein.";
Genomics 64:324-330(2000).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=10591208; DOI=10.1038/990031;
Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M.,
Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K.,
Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P.,
Bird C.P., Blakey S.E., Bridgeman A.M., Buck D., Burgess J.,
Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G.,
Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R.,
Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E.,
Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G.,
Evans K.L., Fey J.M., Fleming K., French L., Garner A.A.,
Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C.,
Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S.,
Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A.,
Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M.,
Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T.,
Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J.,
Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T.,
Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T.,
Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L.,
Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M.,
Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L.,
Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L.,
Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N.,
Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J.,
Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S.,
Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T.,
Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I.,
Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H.,
Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L.,
Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z.,
Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P.,
Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S.,
Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J.,
Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T.,
Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J.,
Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R.,
Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S.,
Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E.,
Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P.,
Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E.,
O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X.,
Khan A.S., Lane L., Tilahun Y., Wright H.;
"The DNA sequence of human chromosome 22.";
Nature 402:489-495(1999).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3).
Adams M.D.;
Submitted (JUN-1996) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 289-824.
PubMed=12529303; DOI=10.1101/gr.695703;
Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J.,
Knowles S., Bye J.M., Beare D.M., Dunham I.;
"Reevaluating human gene annotation: a second-generation analysis of
chromosome 22.";
Genome Res. 13:27-36(2003).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 599-824 (ISOFORM 1).
TISSUE=Brain;
PubMed=9110174;
Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W.,
Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.;
"Large-scale concatenation cDNA sequencing.";
Genome Res. 7:353-358(1997).
[8]
INTERACTION WITH FGF13 AND MAPK13.
PubMed=11378392; DOI=10.1016/S0960-9822(01)00232-9;
Schoorlemmer J., Goldfarb M.;
"Fibroblast growth factor homologous factors are intracellular
signaling proteins.";
Curr. Biol. 11:793-797(2001).
-!- FUNCTION: The JNK-interacting protein (JIP) group of scaffold
proteins selectively mediates JNK signaling by aggregating
specific components of the MAPK cascade to form a functional JNK
signaling module. JIP2 inhibits IL1 beta-induced apoptosis in
insulin-secreting cells. May function as a regulator of vesicle
transport, through interactions with the JNK-signaling components
and motor proteins (By similarity). {ECO:0000250}.
-!- SUBUNIT: Forms homo- or heterooligomeric complexes. Binds specific
components of the JNK signaling pathway namely JNK1, JNK2, JNK3,
MAP2K7, MAP3K10, MAP3K11, MAP3K12 and MAPK13. Also binds the
proline-rich domain-containing splice variant of apolipoprotein E
receptor 2 (ApoER2). Binds the cytoplasmic tails of LRP1 and LRP2
(Megalin). Binds the TPR motif-containing C-terminal of kinesin
light chain, Klc1, pre-assembled MAPK8IP1 scaffolding complexes
are then transported as a cargo of kinesin, to the required
subcellular location (By similarity). Interacts with the
cytoplasmic domain of APP (By similarity). Interacts with DCLK2.
Interacts with TIAM1 and TIAM2 (By similarity). Interacts with
FGF13; enables the interaction with MAPK13 and may regulate the
MAPK8IP2 scaffolding activity. Interacts with SH3RF2 (By
similarity). {ECO:0000250|UniProtKB:G3V9M2,
ECO:0000250|UniProtKB:Q9ERE9, ECO:0000269|PubMed:10490659,
ECO:0000269|PubMed:11378392}.
-!- INTERACTION:
Q53HF2:-; NbExp=2; IntAct=EBI-722813, EBI-877761;
Q15389-2:ANGPT1; NbExp=3; IntAct=EBI-722813, EBI-10692491;
P00533:EGFR; NbExp=4; IntAct=EBI-722813, EBI-297353;
P04626:ERBB2; NbExp=3; IntAct=EBI-722813, EBI-641062;
O15205:UBD; NbExp=3; IntAct=EBI-722813, EBI-6657186;
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10490659}.
Note=Accumulates in cell surface projections.
{ECO:0000269|PubMed:10490659}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Comment=Experimental confirmation may be lacking for some
isoforms.;
Name=1;
IsoId=Q13387-1; Sequence=Displayed;
Name=2;
IsoId=Q13387-2; Sequence=VSP_002770;
Name=3;
IsoId=Q13387-3; Sequence=VSP_002770, VSP_002772, VSP_002773,
VSP_002774;
Note=Might be artifactual as it is only predicted from a genomic
sequence.;
Name=4;
IsoId=Q13387-4; Sequence=VSP_002771;
-!- TISSUE SPECIFICITY: Expressed mainly in the brain and pancreas,
including insulin-secreting cells. In the nervous system, more
abundantly expressed in the cerebellum, pituitary gland, occipital
lobe and the amygdala. Also expressed in fetal brain. Very low
levels found in uterus, ovary, prostate, colon, testis, adrenal
gland, thyroid gland and salivary gland.
-!- SIMILARITY: Belongs to the JIP scaffold family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=CAA16714.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF136382; AAF00980.1; -; mRNA.
EMBL; AF218778; AAF32323.1; -; mRNA.
EMBL; U62317; AAB03340.1; -; Genomic_DNA.
EMBL; BC009940; AAH09940.2; -; mRNA.
EMBL; AL021708; CAA16714.1; ALT_INIT; mRNA.
EMBL; U79261; AAB50207.1; -; mRNA.
CCDS; CCDS74886.1; -. [Q13387-1]
RefSeq; NP_036456.1; NM_012324.4. [Q13387-1]
UniGene; Hs.558180; -.
UniGene; Hs.656617; -.
ProteinModelPortal; Q13387; -.
SMR; Q13387; -.
BioGrid; 117086; 95.
IntAct; Q13387; 72.
MINT; Q13387; -.
STRING; 9606.ENSP00000330572; -.
MoonDB; Q13387; Predicted.
iPTMnet; Q13387; -.
PhosphoSitePlus; Q13387; -.
BioMuta; MAPK8IP2; -.
DMDM; 17433017; -.
PaxDb; Q13387; -.
PeptideAtlas; Q13387; -.
PRIDE; Q13387; -.
ProteomicsDB; 59356; -.
ProteomicsDB; 59357; -. [Q13387-2]
ProteomicsDB; 59358; -. [Q13387-3]
ProteomicsDB; 59359; -. [Q13387-4]
DNASU; 23542; -.
Ensembl; ENST00000329492; ENSP00000330572; ENSG00000008735. [Q13387-1]
GeneID; 23542; -.
KEGG; hsa:23542; -.
UCSC; uc032qrw.2; human. [Q13387-1]
CTD; 23542; -.
DisGeNET; 23542; -.
EuPathDB; HostDB:ENSG00000008735.13; -.
GeneCards; MAPK8IP2; -.
HGNC; HGNC:6883; MAPK8IP2.
HPA; HPA034780; -.
MIM; 607755; gene.
neXtProt; NX_Q13387; -.
OpenTargets; ENSG00000008735; -.
PharmGKB; PA30627; -.
eggNOG; KOG3775; Eukaryota.
eggNOG; ENOG410ZFRJ; LUCA.
GeneTree; ENSGT00390000003908; -.
HOGENOM; HOG000231470; -.
HOVERGEN; HBG018568; -.
InParanoid; Q13387; -.
KO; K04435; -.
OMA; HKHRPTT; -.
OrthoDB; EOG091G0T9G; -.
PhylomeDB; Q13387; -.
SignaLink; Q13387; -.
SIGNOR; Q13387; -.
ChiTaRS; MAPK8IP2; human.
GeneWiki; MAPK8IP2; -.
GenomeRNAi; 23542; -.
PRO; PR:Q13387; -.
Proteomes; UP000005640; Chromosome 22.
Bgee; ENSG00000008735; -.
CleanEx; HS_MAPK8IP2; -.
Genevisible; Q13387; HS.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0005622; C:intracellular; IEA:GOC.
GO; GO:0043025; C:neuronal cell body; IEA:Ensembl.
GO; GO:0014069; C:postsynaptic density; ISS:BHF-UCL.
GO; GO:0032991; C:protein-containing complex; IEA:Ensembl.
GO; GO:0001540; F:amyloid-beta binding; NAS:UniProtKB.
GO; GO:0019894; F:kinesin binding; ISS:UniProtKB.
GO; GO:0005078; F:MAP-kinase scaffold activity; IDA:UniProtKB.
GO; GO:0030295; F:protein kinase activator activity; IDA:MGI.
GO; GO:0019901; F:protein kinase binding; IPI:UniProtKB.
GO; GO:0044877; F:protein-containing complex binding; IEA:Ensembl.
GO; GO:0005198; F:structural molecule activity; TAS:ProtInc.
GO; GO:0001662; P:behavioral fear response; ISS:BHF-UCL.
GO; GO:0048813; P:dendrite morphogenesis; ISS:BHF-UCL.
GO; GO:0060079; P:excitatory postsynaptic potential; ISS:BHF-UCL.
GO; GO:0007254; P:JNK cascade; IEA:Ensembl.
GO; GO:0000165; P:MAPK cascade; IDA:MGI.
GO; GO:0007617; P:mating behavior; IEA:Ensembl.
GO; GO:2001234; P:negative regulation of apoptotic signaling pathway; IDA:UniProtKB.
GO; GO:0046958; P:nonassociative learning; ISS:BHF-UCL.
GO; GO:0032874; P:positive regulation of stress-activated MAPK cascade; IEA:Ensembl.
GO; GO:2000311; P:regulation of AMPA receptor activity; ISS:BHF-UCL.
GO; GO:0046328; P:regulation of JNK cascade; IDA:UniProtKB.
GO; GO:2000310; P:regulation of NMDA receptor activity; ISS:BHF-UCL.
GO; GO:0010469; P:regulation of signaling receptor activity; ISS:BHF-UCL.
GO; GO:0051966; P:regulation of synaptic transmission, glutamatergic; ISS:BHF-UCL.
GO; GO:0007172; P:signal complex assembly; TAS:ProtInc.
GO; GO:0035176; P:social behavior; ISS:BHF-UCL.
CDD; cd11942; SH3_JIP2; 1.
Gene3D; 2.30.29.30; -; 1.
InterPro; IPR035637; JIP2_SH3.
InterPro; IPR011993; PH-like_dom_sf.
InterPro; IPR006020; PTB/PI_dom.
InterPro; IPR001452; SH3_domain.
Pfam; PF00640; PID; 1.
Pfam; PF14604; SH3_9; 1.
SMART; SM00462; PTB; 1.
SMART; SM00326; SH3; 1.
PROSITE; PS01179; PID; 1.
PROSITE; PS50002; SH3; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm; Phosphoprotein;
Polymorphism; Reference proteome; SH3 domain.
CHAIN 1 824 C-Jun-amino-terminal kinase-interacting
protein 2.
/FTId=PRO_0000220631.
DOMAIN 604 665 SH3. {ECO:0000255|PROSITE-
ProRule:PRU00192}.
DOMAIN 677 813 PID. {ECO:0000255|PROSITE-
ProRule:PRU00148}.
REGION 110 275 JNK-binding domain (JBD).
REGION 239 498 Necessary for interaction with FGF13.
{ECO:0000269|PubMed:11378392}.
COMPBIAS 30 36 Asp/Glu-rich (acidic).
COMPBIAS 85 103 Asp/Glu-rich (acidic).
COMPBIAS 279 291 Ser-rich.
COMPBIAS 417 434 Pro-rich.
COMPBIAS 469 481 Asp/Glu-rich (acidic).
MOD_RES 254 254 Phosphoserine.
{ECO:0000250|UniProtKB:Q9ERE9}.
MOD_RES 302 302 Phosphoserine.
{ECO:0000250|UniProtKB:Q9ERE9}.
MOD_RES 305 305 Phosphoserine.
{ECO:0000250|UniProtKB:Q9ERE9}.
VAR_SEQ 1 57 MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEIT
DDCGLGLSYDSDHCEK -> MLPDFPSPSTWAPGLLLPSGP
ALLSPSVLQ (in isoform 2 and isoform 3).
{ECO:0000303|PubMed:10756100}.
/FTId=VSP_002770.
VAR_SEQ 88 468 Missing (in isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_002771.
VAR_SEQ 152 394 Missing (in isoform 3). {ECO:0000305}.
/FTId=VSP_002772.
VAR_SEQ 415 439 Missing (in isoform 3). {ECO:0000305}.
/FTId=VSP_002773.
VAR_SEQ 768 768 C -> CEAPQGAAFQWERGVDRKRVLQTRGNVQPHLGAGQG
AALNRATEGSSTGSEKGEWTPLVIMELTQSVNSC (in
isoform 3). {ECO:0000305}.
/FTId=VSP_002774.
VARIANT 743 743 P -> L (in dbSNP:rs1140555).
/FTId=VAR_049666.
SEQUENCE 824 AA; 87975 MW; 7EFC8F3BC58E37BB CRC64;
MADRAEMFSL STFHSLSPPG CRPPQDISLE EFDDEDLSEI TDDCGLGLSY DSDHCEKDSL
SLGRSEQPHP ICSFQDDFQE FEMIDDNEEE DDEDEEEEEE EEEGDGEGQE GGDPGSEAPA
PGPLIPSPSV EEPHKHRPTT LRLTTLGAQD SLNNNGGFDL VRPASWQETA LCSPAPEALR
ELPGPLPATD TGPGGAQSPV RPGCDCEGNR PAEPPAPGGT SPSSDPGIEA DLRSRSSGGR
GGRRSSQELS SPGSDSEDAG GARLGRMISS ISETELELSS DGGSSSSGRS SHLTNSIEEA
SSPASEPEPP REPPRRPAFL PVGPDDTNSE YESGSESEPD LSEDADSPWL LSNLVSRMIS
EGSSPIRCPG QCLSPAPRPP GEPVSPAGGA AQDSQDPEAA AGPGGVELVD METLCAPPPP
APAAPRPGPA QPGPCLFLSN PTRDTITPLW AAPGRAARPG RACSAACSEE EDEEDDEEEE
DAEDSAGSPG GRGTGPSAPR DASLVYDAVK YTLVVDEHTQ LELVSLRRCA GLGHDSEEDS
GGEASEEEAG AALLGGGQVS GDTSPDSPDL TFSKKFLNVF VNSTSRSSST ESFGLFSCLV
NGEEREQTHR AVFRFIPRHP DELELDVDDP VLVEAEEDDF WFRGFNMRTG ERGVFPAFYA
HAVPGPAKDL LGSKRSPCWV ERFDVQFLGS VEVPCHQGNG ILCAAMQKIA TARKLTVHLR
PPASCDLEIS LRGVKLSLSG GGPEFQRCSH FFQMKNISFC GCHPRNSCYF GFITKHPLLS
RFACHVFVSQ ESMRPVAQSV GRAFLEYYQE HLAYACPTED IYLE


Related products :

Catalog number Product name Quantity
EIAAB38485 Homo sapiens,Human,MAPKAP1,MIP1,Mitogen-activated protein kinase 2-associated protein 1,mSIN1,SAPK-interacting protein 1,SIN1,Stress-activated map kinase-interacting protein 1,Target of rapamycin comp
EIAAB38487 Mapkap1,Mip1,Mitogen-activated protein kinase 2-associated protein 1,Rat,Rattus norvegicus,SAPK-interacting protein 1,Sin1,Stress-activated map kinase-interacting protein 1,Target of rapamycin complex
EIAAB38489 Bos taurus,Bovine,MAPKAP1,Mitogen-activated protein kinase 2-associated protein 1,SAPK-interacting protein 1,SIN1,Stress-activated map kinase-interacting protein 1,Target of rapamycin complex 2 subuni
EIAAB38486 Mapkap1,Mip1,Mitogen-activated protein kinase 2-associated protein 1,Mouse,Mus musculus,SAPK-interacting protein 1,Sin1,Stress-activated map kinase-interacting protein 1,Target of rapamycin complex 2
EIAAB41234 Homo sapiens,Human,MAP3K7IP3,Mitogen-activated protein kinase kinase kinase 7-interacting protein 3,NF-kappa-B-activating protein 1,TAB3,TAB-3,TAK1-binding protein 3,TGF-beta-activated kinase 1 and MA
EIAAB38488 Chicken,Gallus gallus,MAPKAP1,Mitogen-activated protein kinase 2-associated protein 1,SAPK-interacting protein 1,SIN1,Stress-activated map kinase-interacting protein 1,Target of rapamycin complex 2 su
EIAAB41230 Homo sapiens,Human,KIAA0733,MAP3K7IP2,Mitogen-activated protein kinase kinase kinase 7-interacting protein 2,TAB2,TAB-2,TAK1-binding protein 2,TGF-beta-activated kinase 1 and MAP3K7-binding protein 2,
EIAAB41231 Kiaa0733,Map3k7ip2,Mitogen-activated protein kinase kinase kinase 7-interacting protein 2,Mouse,Mus musculus,Tab2,TAB-2,TAK1-binding protein 2,TGF-beta-activated kinase 1 and MAP3K7-binding protein 2,
EIAAB41233 Kiaa4135,Map3k7ip3,Mitogen-activated protein kinase kinase kinase 7-interacting protein 3,Mouse,Mus musculus,Tab3,TAB-3,TAK1-binding protein 3,TGF-beta-activated kinase 1 and MAP3K7-binding protein 3,
EIAAB31218 Homo sapiens,hPIP1,Human,p21-activated protein kinase-interacting protein 1,PAK_PLC-interacting protein 1,PAK1-interacting protein 1,PAK1IP1,PIP1,WD repeat-containing protein 84,WDR84
EIAAB24833 Bos taurus,Bovine,MAPK1IP1L,MAPK-interacting and spindle-stabilizing protein-like,Mitogen-activated protein kinase 1-interacting protein 1-like
EIAAB24831 Mapk1ip1l,MAPK-interacting and spindle-stabilizing protein-like,Mitogen-activated protein kinase 1-interacting protein 1-like,Mouse,Mus musculus
EIAAB24830 Mapk1ip1,MAPK-interacting and spindle-stabilizing protein,Miss,Mitogen-activated protein kinase 1-interacting protein 1,Mouse,Mus musculus
EIAAB24832 C14orf32,Homo sapiens,Human,MAPK1IP1L,MAPK-interacting and spindle-stabilizing protein-like,Mitogen-activated protein kinase 1-interacting protein 1-like
EIAAB41228 Homo sapiens,Human,MAP3K7IP1,Mitogen-activated protein kinase kinase kinase 7-interacting protein 1,TAB1,TAK1-binding protein 1,TGF-beta-activated kinase 1 and MAP3K7-binding protein 1,TGF-beta-activa
EIAAB41229 Map3k7ip1,Mitogen-activated protein kinase kinase kinase 7-interacting protein 1,Mouse,Mus musculus,Tab1,TAK1-binding protein 1,TGF-beta-activated kinase 1 and MAP3K7-binding protein 1,TGF-beta-activa
18-003-42203 Mitogen-activated protein kinase kinase kinase 7-interacting protein 2 - TAK1-binding protein 2 Polyclonal 0.05 mg Aff Pur
EIAAB41232 Map3k7ip2,Mitogen-activated protein kinase kinase kinase 7-interacting protein 2,Rat,Rattus norvegicus,Tab2,TGF-beta-activated kinase 1 and MAP3K7-binding protein 2,TGF-beta-activated kinase 1-binding
18-661-15208 Mitogen-activated protein kinase kinase kinase 7-interacting protein 1 - TGF-beta-activated kinase 1-binding protein 1; TAK1-binding protein 1 Polyclonal 0.1 mg
GS-1261a mitogen-activated protein kinase kinase kinase 7 interacting protein 1 primary antibody, Host: Rabbit 200ul
GWB-C80997 Anti- MAP3K7IP2 (mitogen-activated protein kinase kinase kinase 7 interacting protein 2) Antibody
EIAAB29564 52 kDa repressor of the inhibitor of the protein kinase,58 kDa interferon-induced protein kinase-interacting protein,Mouse,Mus musculus,p52rIPK,p58IPK-interacting protein,Prkrir,THAP domain-containing
CSB-EL013431HU Human mitogen-activated protein kinase kinase kinase 7 interacting protein 2 (MAP3K7IP2) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL013430HU Human mitogen-activated protein kinase kinase kinase 7 interacting protein 1 (MAP3K7IP1) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL013432HU Human mitogen-activated protein kinase kinase kinase 7 interacting protein 3 (MAP3K7IP3) ELISA kit, Species Human, Sample Type serum, plasma 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur