Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

CD177 antigen (Human neutrophil alloantigen 2a) (HNA-2a) (NB1 glycoprotein) (NB1 GP) (Polycythemia rubra vera protein 1) (PRV-1) (CD antigen CD177)

 CD177_HUMAN             Reviewed;         437 AA.
Q8N6Q3; Q711Q2; Q8NCV9; Q96QH1; Q9HDA5;
04-APR-2006, integrated into UniProtKB/Swiss-Prot.
04-APR-2006, sequence version 2.
28-FEB-2018, entry version 111.
RecName: Full=CD177 antigen {ECO:0000312|HGNC:HGNC:30072};
AltName: Full=Human neutrophil alloantigen 2a {ECO:0000305|PubMed:11465086};
Short=HNA-2a {ECO:0000305|PubMed:11465086};
AltName: Full=NB1 glycoprotein {ECO:0000305|PubMed:11465086};
Short=NB1 GP {ECO:0000305|PubMed:11465086};
AltName: Full=Polycythemia rubra vera protein 1 {ECO:0000303|PubMed:10753836};
Short=PRV-1 {ECO:0000303|PubMed:10753836};
AltName: CD_antigen=CD177;
Flags: Precursor;
Name=CD177 {ECO:0000312|HGNC:HGNC:30072};
Synonyms=NB1, PRV1 {ECO:0000303|PubMed:10753836};
ORFNames=UNQ595/PRO1181;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ILE-251, TISSUE
SPECIFICITY, AND INDUCTION.
PubMed=10753836;
Temerinac S., Klippel S., Strunck E., Roeder S., Luebbert M.,
Lange W., Azemar M., Meinhardt G., Schaefer H.-E., Pahl H.L.;
"Cloning of PRV-1, a novel member of the uPAR receptor superfamily,
which is overexpressed in polycythemia rubra vera.";
Blood 95:2569-2576(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 35-45;
167-175 AND 386-393, VARIANTS PRO-3; PHE-119; ILE-251; GLN-323 AND
SER-379, MASS SPECTROMETRY, AND GLYCOSYLATION.
PubMed=11465086;
DOI=10.1002/1521-4141(200105)31:5<1301::AID-IMMU1301>3.0.CO;2-J;
Kissel K., Santoso S., Hofmann C., Stroncek D., Bux J.;
"Molecular basis of the neutrophil glycoprotein NB1 (CD177) involved
in the pathogenesis of immunenneutropenia and transfusion reactions.";
Eur. J. Immunol. 31:1301-1309(2001).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), AND VARIANT PRO-3.
PubMed=12010833; DOI=10.1182/blood.V99.11.4231;
Kissel K., Scheffler S., Kerowgan M., Bux J.;
"Molecular basis of NB1 (HNA-2a, CD177) deficiency.";
Blood 99:4231-4233(2002).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
ILE-251.
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
ILE-251.
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANTS PRO-3
AND THR-348.
TISSUE=Colon;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
PROTEIN SEQUENCE OF 22-36.
PubMed=15340161; DOI=10.1110/ps.04682504;
Zhang Z., Henzel W.J.;
"Signal peptide prediction based on analysis of experimentally
verified cleavage sites.";
Protein Sci. 13:2819-2824(2004).
[8]
SUBCELLULAR LOCATION, GLYCOSYLATION, AND SHEDDING.
PubMed=12239154; DOI=10.1182/blood-2002-03-0949;
Klippel S., Strunck E., Busse C.E., Behringer D., Pahl H.L.;
"Biochemical characterization of PRV-1, a novel hematopoietic cell
surface receptor, which is overexpressed in polycythemia rubra vera.";
Blood 100:2441-2448(2002).
[9]
INDUCTION, AND TISSUE SPECIFICITY.
PubMed=12377969; DOI=10.1200/JCO.2002.11.507;
Teofili L., Martini M., Luongo M., Di Mario A., Leone G.,
De Stefano V., Larocca L.M.;
"Overexpression of the polycythemia rubra vera-1 gene in essential
thrombocythemia.";
J. Clin. Oncol. 20:4249-4254(2002).
[10]
SUBCELLULAR LOCATION, TISSUE SPECIFICITY, AND INDUCTION.
PubMed=12675722;
Caruccio L., Bettinotti M., Matsuo K., Sharon V., Stroncek D.;
"Expression of human neutrophil antigen-2a (NB1) is increased in
pregnancy.";
Transfusion 43:357-363(2003).
[11]
FUNCTION, INTERACTION WITH PRTN3, SUBCELLULAR LOCATION, TISSUE
SPECIFICITY, AND INDUCTION.
PubMed=17244676; DOI=10.1182/blood-2006-10-055327;
von Vietinghoff S., Tunnemann G., Eulenberg C., Wellner M.,
Cristina Cardoso M., Luft F.C., Kettritz R.;
"NB1 mediates surface expression of the ANCA antigen proteinase 3 on
human neutrophils.";
Blood 109:4487-4493(2007).
[12]
FUNCTION, INTERACTION WITH PECAM1, SUBCELLULAR LOCATION, AND TISSUE
SPECIFICITY.
PubMed=17580308; DOI=10.1074/jbc.M701120200;
Sachs U.J., Andrei-Selmer C.L., Maniar A., Weiss T., Paddock C.,
Orlova V.V., Choi E.Y., Newman P.J., Preissner K.T., Chavakis T.,
Santoso S.;
"The neutrophil-specific antigen CD177 is a counter-receptor for
platelet endothelial cell adhesion molecule-1 (CD31).";
J. Biol. Chem. 282:23603-23612(2007).
[13]
FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL
STAGE, AND INDUCTION.
PubMed=18462208; DOI=10.1111/j.1365-2249.2008.03663.x;
von Vietinghoff S., Eulenberg C., Wellner M., Luft F.C., Kettritz R.;
"Neutrophil surface presentation of the anti-neutrophil cytoplasmic
antibody-antigen proteinase 3 depends on N-terminal processing.";
Clin. Exp. Immunol. 152:508-516(2008).
[14]
FUNCTION, IDENTIFICATION IN A COMPLEX WITH ITGAM AND ITGB2,
SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=21193407; DOI=10.1074/jbc.M110.171256;
Jerke U., Rolle S., Dittmar G., Bayat B., Santoso S., Sporbert A.,
Luft F., Kettritz R.;
"Complement receptor Mac-1 is an adaptor for NB1 (CD177)-mediated PR3-
ANCA neutrophil activation.";
J. Biol. Chem. 286:7070-7081(2011).
[15]
FUNCTION.
PubMed=23202369; DOI=10.1161/ATVBAHA.112.300474;
Kuckleburg C.J., Newman P.J.;
"Neutrophil proteinase 3 acts on protease-activated receptor-2 to
enhance vascular endothelial cell barrier function.";
Arterioscler. Thromb. Vasc. Biol. 33:275-284(2013).
[16]
FUNCTION.
PubMed=23461681; DOI=10.1111/ejh.12095;
Wang L., Ge S., Agustian A., Hiss M., Haller H., von Vietinghoff S.;
"Surface receptor CD177/NB1 does not confer a recruitment advantage to
neutrophilic granulocytes during human peritonitis.";
Eur. J. Haematol. 90:436-437(2013).
[17]
SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=24926686; DOI=10.1371/journal.pone.0099671;
Hu N., Mora-Jensen H., Theilgaard-Moench K., Doornbos-van der Meer B.,
Huitema M.G., Stegeman C.A., Heeringa P., Kallenberg C.G., Westra J.;
"Differential expression of granulopoiesis related genes in neutrophil
subsets distinguished by membrane expression of CD177.";
PLoS ONE 9:E99671-E99671(2014).
[18]
FUNCTION, IDENTIFICATION IN A COMPLEX WITH ITGAM AND ITGB2,
SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=28807980; DOI=10.1182/blood-2017-03-768507;
Bai M., Grieshaber-Bouyer R., Wang J., Schmider A.B., Wilson Z.S.,
Zeng L., Halyabar O., Godin M.D., Nguyen H.N., Levescot A., Cunin P.,
Lefort C.T., Soberman R.J., Nigrovic P.A.;
"CD177 modulates human neutrophil migration through activation-
mediated integrin and chemoreceptor regulation.";
Blood 130:2092-2100(2017).
[19]
INTERACTION WITH PRTN3, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=28240246; DOI=10.1038/srep43328;
Jerke U., Marino S.F., Daumke O., Kettritz R.;
"Characterization of the CD177 interaction with the ANCA antigen
proteinase 3.";
Sci. Rep. 7:43328-43328(2017).
[20]
VARIANT THR-348, AND POLYMORPHISM.
PubMed=12623849; DOI=10.1182/blood-2002-09-2831;
Wolff J., Brendel C., Fink L., Bohle R.M., Kissel K., Bux J.;
"Lack of NB1 GP (CD177/HNA-2a) gene transcription in NB1 GP-
neutrophils from NB1 GP-expressing individuals and association of low
expression with NB1 gene polymorphisms.";
Blood 102:731-733(2003).
[21]
VARIANTS PRO-3; PHE-119; GLN-323 AND SER-379, AND POLYMORPHISM.
PubMed=14692971; DOI=10.1046/j.0041-1132.2004.00606.x;
Caruccio L., Walkovich K., Bettinotti M., Schuller R., Stroncek D.;
"CD177 polymorphisms: correlation between high-frequency single
nucleotide polymorphisms and neutrophil surface protein expression.";
Transfusion 44:77-82(2004).
[22]
VARIANTS PRO-3; LEU-31; ILE-251; ALA-261; THR-348 AND ARG-431,
SUBCELLULAR LOCATION, TISSUE SPECIFICITY, AND POLYMORPHISM.
PubMed=27227454; DOI=10.1371/journal.pgen.1006067;
Wu Z., Liang R., Ohnesorg T., Cho V., Lam W., Abhayaratna W.P.,
Gatenby P.A., Perera C., Zhang Y., Whittle B., Sinclair A.,
Goodnow C.C., Field M., Andrews T.D., Cook M.C.;
"Heterogeneity of human neutrophil CD177 expression results from
CD177P1 pseudogene conversion.";
PLoS Genet. 12:E1006067-E1006067(2016).
-!- FUNCTION: In association with beta-2 integrin heterodimer
ITGAM/CD11b and ITGB2/CD18, mediates activation of TNF-alpha
primed neutrophils including degranulation and superoxide
production (PubMed:21193407). In addition, by preventing beta-2
integrin internalization and attenuating chemokine signaling
favors adhesion over migration (PubMed:28807980). Heterophilic
interaction with PECAM1 on endothelial cells plays a role in
neutrophil transendothelial migration in vitro (PubMed:17580308).
However, appears to be dispensable for neutrophil recruitment
caused by bacterial infection in vivo (PubMed:23461681). Acts as a
receptor for the mature form of protease PRTN3 allowing its
display at the cell surface of neutrophils (PubMed:17244676,
PubMed:18462208). By displaying PRTN3 at the neutrophil cell
surface, may play a role in enhancing endothelial cell junctional
integrity and thus vascular integrity during neutrophil diapedesis
(PubMed:23202369). {ECO:0000269|PubMed:17244676,
ECO:0000269|PubMed:17580308, ECO:0000269|PubMed:18462208,
ECO:0000269|PubMed:21193407, ECO:0000269|PubMed:23202369,
ECO:0000269|PubMed:23461681, ECO:0000269|PubMed:28807980}.
-!- SUBUNIT: Found in a complex with integrin ITGAM/CD11b and
ITGB2/CD18 (PubMed:28807980, PubMed:21193407). Interacts with
PECAM1 (via Ig-like C2-type domain 6); the interaction is Ca(2+)-
dependent; the interaction is direct (PubMed:17580308). Interacts
with serine protease PRTN3/myeloblastin; the interaction tethers
PRTN3 to the cell surface; the interaction is direct
(PubMed:17244676, PubMed:28240246). {ECO:0000269|PubMed:17244676,
ECO:0000269|PubMed:17580308, ECO:0000269|PubMed:21193407,
ECO:0000269|PubMed:28240246, ECO:0000269|PubMed:28807980}.
-!- INTERACTION:
Q9Y2W7:KCNIP3; NbExp=6; IntAct=EBI-747170, EBI-751501;
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:12239154,
ECO:0000269|PubMed:12675722, ECO:0000269|PubMed:17244676,
ECO:0000269|PubMed:17580308, ECO:0000269|PubMed:18462208,
ECO:0000269|PubMed:21193407, ECO:0000269|PubMed:24926686,
ECO:0000269|PubMed:27227454, ECO:0000269|PubMed:28240246,
ECO:0000269|PubMed:28807980}; Lipid-anchor, GPI-anchor
{ECO:0000269|PubMed:12239154, ECO:0000269|PubMed:17244676}.
Membrane raft {ECO:0000269|PubMed:21193407}; Lipid-anchor, GPI-
like-anchor {ECO:0000269|PubMed:12239154,
ECO:0000269|PubMed:17244676}. Secreted
{ECO:0000269|PubMed:12239154, ECO:0000269|PubMed:18462208}.
Cytoplasmic granule membrane {ECO:0000269|PubMed:18462208}. Cell
projection, lamellipodium {ECO:0000269|PubMed:28807980}. Note=Cell
surface expression on neutrophils is increased upon TNF-alpha,
fMLP or CXCL8/IL8-mediated stimulation (PubMed:17244676,
PubMed:17580308). In neutrophils, stored predominantly in
secondary and tertiary granules (PubMed:18462208). Can also be
shedded from the cell membrane (PubMed:12239154, PubMed:18462208).
Localizes to lamellar protrusions in spreading neutrophils
(PubMed:28807980). {ECO:0000269|PubMed:12239154,
ECO:0000269|PubMed:17244676, ECO:0000269|PubMed:17580308,
ECO:0000269|PubMed:18462208, ECO:0000269|PubMed:28807980}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q8N6Q3-1; Sequence=Displayed;
Name=2;
IsoId=Q8N6Q3-2; Sequence=VSP_017860, VSP_017861;
Note=Associated with CD177-negative phenotype.;
Name=3;
IsoId=Q8N6Q3-3; Sequence=VSP_017858, VSP_017859;
Note=Associated with CD177-negative phenotype.;
-!- TISSUE SPECIFICITY: Highly expressed in normal bone marrow and
weakly expressed in fetal liver (PubMed:10753836). During
neutrophil differentiation, expression begins at the metamyelocyte
stage and continues throughout the subsequent stages (at protein
level) (PubMed:17244676, PubMed:18462208, PubMed:24926686).
Expressed by a subset of mature neutrophils (at protein level)
(PubMed:10753836, PubMed:28240246, PubMed:12377969,
PubMed:18462208, PubMed:12675722, PubMed:17244676,
PubMed:17580308, PubMed:21193407, PubMed:24926686,
PubMed:28807980, PubMed:27227454). The percentage of neutrophils
expressing CD177 varies across the population (PubMed:17244676,
PubMed:27227454). Expressed in granulocytes of patients with
polycythemia vera (PV) and with essential thrombocythemia (ET)
(PubMed:10753836, PubMed:12377969). {ECO:0000269|PubMed:10753836,
ECO:0000269|PubMed:12377969, ECO:0000269|PubMed:12675722,
ECO:0000269|PubMed:17244676, ECO:0000269|PubMed:17580308,
ECO:0000269|PubMed:18462208, ECO:0000269|PubMed:21193407,
ECO:0000269|PubMed:27227454, ECO:0000269|PubMed:28240246,
ECO:0000269|PubMed:28807980}.
-!- DEVELOPMENTAL STAGE: Expressed in neonatal and adult neutrophils.
{ECO:0000269|PubMed:18462208}.
-!- INDUCTION: By CSF3/G-CSF in resting granulocytes
(PubMed:10753836). Induced during CSF3/G-CSF-mediated neutrophil
differentiation (PubMed:17244676, PubMed:18462208). Induced during
pregnancy (PubMed:12675722). Induced in patients with polycythemia
vera (PV) and with essential thrombocythemia (ET)
(PubMed:10753836, PubMed:12377969). {ECO:0000269|PubMed:10753836,
ECO:0000269|PubMed:12377969, ECO:0000269|PubMed:12675722,
ECO:0000269|PubMed:17244676, ECO:0000269|PubMed:18462208}.
-!- PTM: N-glycosylated. {ECO:0000269|PubMed:11465086,
ECO:0000269|PubMed:12239154}.
-!- PTM: A soluble form may also be produced by proteolytic cleavage
at the cell surface (shedding). {ECO:0000269|PubMed:12239154,
ECO:0000269|PubMed:18462208}.
-!- MASS SPECTROMETRY: Mass=50556; Method=MALDI; Range=22-408;
Evidence={ECO:0000269|PubMed:11465086};
-!- POLYMORPHISM: There is a significant association between the
variants Ala-3, Leu-251 and Thr-348 and a low expression of CD177
on neutrophils (PubMed:12623849, PubMed:14692971). Expression of
CD177 on neutrophils is a trait determined by ratio of
CD177/CD177P1 alleles (PubMed:27227454). The phenotype of CD177
null neutrophils is due to recombination between exon 7 of CD177
and the pseudogene CD177P1 through gene conversion, changing Lys-
263 codon into stop codon (PubMed:27227454). The lack of CD177
expression affects 1-10 percent of the population placing them at
risk for formation of anti-neutrophil antibodies that can cause
transfusion-related acute lung injury and neonatal alloimmune
neutropenia. {ECO:0000269|PubMed:12623849,
ECO:0000269|PubMed:14692971, ECO:0000269|PubMed:27227454}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF146747; AAG00895.1; -; mRNA.
EMBL; AJ290452; CAC44459.1; -; mRNA.
EMBL; AJ305326; CAC83758.1; -; mRNA.
EMBL; AJ310433; CAC83724.1; -; mRNA.
EMBL; AY358932; AAQ89291.1; -; mRNA.
EMBL; BT020111; AAV38914.1; -; mRNA.
EMBL; BC029167; AAH29167.1; -; mRNA.
CCDS; CCDS62700.1; -. [Q8N6Q3-1]
RefSeq; NP_065139.2; NM_020406.3.
UniGene; Hs.232165; -.
ProteinModelPortal; Q8N6Q3; -.
BioGrid; 121389; 3.
IntAct; Q8N6Q3; 2.
STRING; 9606.ENSP00000367248; -.
BioMuta; CD177; -.
DMDM; 91208246; -.
PaxDb; Q8N6Q3; -.
PeptideAtlas; Q8N6Q3; -.
PRIDE; Q8N6Q3; -.
DNASU; 57126; -.
Ensembl; ENST00000378012; ENSP00000367251; ENSG00000204936. [Q8N6Q3-3]
GeneID; 57126; -.
KEGG; hsa:57126; -.
UCSC; uc060zla.1; human. [Q8N6Q3-1]
CTD; 57126; -.
DisGeNET; 57126; -.
EuPathDB; HostDB:ENSG00000204936.9; -.
GeneCards; CD177; -.
H-InvDB; HIX0017865; -.
HGNC; HGNC:30072; CD177.
HPA; HPA041820; -.
HPA; HPA046601; -.
MIM; 162860; gene.
neXtProt; NX_Q8N6Q3; -.
OpenTargets; ENSG00000204936; -.
PharmGKB; PA142672147; -.
eggNOG; ENOG410J207; Eukaryota.
eggNOG; ENOG4111D7X; LUCA.
GeneTree; ENSGT00530000063351; -.
HOVERGEN; HBG081064; -.
InParanoid; Q8N6Q3; -.
KO; K06552; -.
PhylomeDB; Q8N6Q3; -.
Reactome; R-HSA-140875; Common Pathway of Fibrin Clot Formation.
Reactome; R-HSA-202733; Cell surface interactions at the vascular wall.
Reactome; R-HSA-6798695; Neutrophil degranulation.
GeneWiki; CD177; -.
GenomeRNAi; 57126; -.
PRO; PR:Q8N6Q3; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000204936; -.
CleanEx; HS_CD177; -.
ExpressionAtlas; Q8N6Q3; baseline and differential.
Genevisible; Q8N6Q3; HS.
GO; GO:0031225; C:anchored component of membrane; IEA:UniProtKB-KW.
GO; GO:0070062; C:extracellular exosome; HDA:UniProtKB.
GO; GO:0030027; C:lamellipodium; IEA:UniProtKB-SubCell.
GO; GO:0005886; C:plasma membrane; IDA:UniProtKB.
GO; GO:0044853; C:plasma membrane raft; IDA:UniProtKB.
GO; GO:0030667; C:secretory granule membrane; IDA:UniProtKB.
GO; GO:0035579; C:specific granule membrane; TAS:Reactome.
GO; GO:0070821; C:tertiary granule membrane; IDA:UniProtKB.
GO; GO:0048306; F:calcium-dependent protein binding; IPI:UniProtKB.
GO; GO:0005178; F:integrin binding; IPI:UniProtKB.
GO; GO:0002020; F:protease binding; IPI:UniProtKB.
GO; GO:0007596; P:blood coagulation; TAS:Reactome.
GO; GO:0007155; P:cell adhesion; IMP:UniProtKB.
GO; GO:0098742; P:cell-cell adhesion via plasma-membrane adhesion molecules; IMP:UniProtKB.
GO; GO:0045217; P:cell-cell junction maintenance; IMP:UniProtKB.
GO; GO:0045087; P:innate immune response; IEA:UniProtKB-KW.
GO; GO:0007159; P:leukocyte cell-cell adhesion; IMP:UniProtKB.
GO; GO:0050900; P:leukocyte migration; TAS:Reactome.
GO; GO:0043312; P:neutrophil degranulation; TAS:Reactome.
GO; GO:0072672; P:neutrophil extravasation; IMP:UniProtKB.
GO; GO:1990266; P:neutrophil migration; IMP:UniProtKB.
GO; GO:0043315; P:positive regulation of neutrophil degranulation; IGI:UniProtKB.
GO; GO:0032930; P:positive regulation of superoxide anion generation; IGI:UniProtKB.
GO; GO:0034394; P:protein localization to cell surface; IMP:UniProtKB.
GO; GO:0030100; P:regulation of endocytosis; IDA:UniProtKB.
GO; GO:2001044; P:regulation of integrin-mediated signaling pathway; IMP:UniProtKB.
InterPro; IPR016054; LY6_UPA_recep-like.
Pfam; PF00021; UPAR_LY6; 2.
1: Evidence at protein level;
Alternative splicing; Cell adhesion; Cell membrane; Cell projection;
Complete proteome; Direct protein sequencing; Glycoprotein;
GPI-anchor; Immunity; Innate immunity; Lipoprotein; Membrane;
Polymorphism; Reference proteome; Repeat; Secreted; Signal.
SIGNAL 1 21 {ECO:0000269|PubMed:15340161}.
CHAIN 22 408 CD177 antigen.
/FTId=PRO_0000231643.
PROPEP 409 437 Removed in mature form. {ECO:0000255}.
/FTId=PRO_0000231644.
DOMAIN 133 210 UPAR/Ly6 1.
DOMAIN 325 377 UPAR/Ly6 2.
LIPID 408 408 GPI-anchor amidated glycine.
{ECO:0000255}.
CARBOHYD 189 189 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 129 145 GSLRCPVCLSMEGCLEG -> MMGAAEGPFGKAEQVDS
(in isoform 3).
{ECO:0000303|PubMed:12010833}.
/FTId=VSP_017858.
VAR_SEQ 146 437 Missing (in isoform 3).
{ECO:0000303|PubMed:12010833}.
/FTId=VSP_017859.
VAR_SEQ 210 248 TCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETL
-> QLKPVGLLEEHNVGEKERGQGQHQCVQLDWQKRAATGI
F (in isoform 2).
{ECO:0000303|PubMed:12010833}.
/FTId=VSP_017860.
VAR_SEQ 249 437 Missing (in isoform 2).
{ECO:0000303|PubMed:12010833}.
/FTId=VSP_017861.
VARIANT 3 3 A -> P (in dbSNP:rs45441892).
{ECO:0000269|PubMed:11465086,
ECO:0000269|PubMed:12010833,
ECO:0000269|PubMed:14692971,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:27227454}.
/FTId=VAR_025858.
VARIANT 31 31 H -> L (in dbSNP:rs45553433).
{ECO:0000269|PubMed:27227454}.
/FTId=VAR_079754.
VARIANT 119 119 L -> F. {ECO:0000269|PubMed:11465086,
ECO:0000269|PubMed:14692971}.
/FTId=VAR_026156.
VARIANT 251 251 L -> I (in dbSNP:rs10425835).
{ECO:0000269|PubMed:10753836,
ECO:0000269|PubMed:11465086,
ECO:0000269|PubMed:12975309,
ECO:0000269|PubMed:27227454,
ECO:0000269|Ref.5}.
/FTId=VAR_025859.
VARIANT 261 261 G -> A. {ECO:0000269|PubMed:27227454}.
/FTId=VAR_079755.
VARIANT 323 323 R -> Q. {ECO:0000269|PubMed:11465086,
ECO:0000269|PubMed:14692971}.
/FTId=VAR_026157.
VARIANT 348 348 A -> T (in dbSNP:rs17856829).
{ECO:0000269|PubMed:12623849,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:27227454}.
/FTId=VAR_025860.
VARIANT 379 379 F -> S. {ECO:0000269|PubMed:11465086,
ECO:0000269|PubMed:14692971}.
/FTId=VAR_026158.
VARIANT 431 431 G -> R (in dbSNP:rs78718189).
{ECO:0000269|PubMed:27227454}.
/FTId=VAR_079756.
CONFLICT 89 89 H -> Y (in Ref. 3; CAC83724).
{ECO:0000305}.
CONFLICT 184 184 G -> V (in Ref. 3; CAC83724).
{ECO:0000305}.
CONFLICT 194 194 I -> F (in Ref. 3; CAC83724).
{ECO:0000305}.
CONFLICT 204 205 NR -> DM (in Ref. 3; CAC83724).
{ECO:0000305}.
SEQUENCE 437 AA; 46363 MW; 3D4716F221934910 CRC64;
MSAVLLLALL GFILPLPGVQ ALLCQFGTVQ HVWKVSDLPR QWTPKNTSCD SGLGCQDTLM
LIESGPQVSL VLSKGCTEAK DQEPRVTEHR MGPGLSLISY TFVCRQEDFC NNLVNSLPLW
APQPPADPGS LRCPVCLSME GCLEGTTEEI CPKGTTHCYD GLLRLRGGGI FSNLRVQGCM
PQPGCNLLNG TQEIGPVGMT ENCNRKDFLT CHRGTTIMTH GNLAQEPTDW TTSNTEMCEV
GQVCQETLLL LDVGLTSTLV GTKGCSTVGA QNSQKTTIHS APPGVLVASY THFCSSDLCN
SASSSSVLLN SLPPQAAPVP GDRQCPTCVQ PLGTCSSGSP RMTCPRGATH CYDGYIHLSG
GGLSTKMSIQ GCVAQPSSFL LNHTRQIGIF SAREKRDVQP PASQHEGGGA EGLESLTWGV
GLALAPALWW GVVCPSC


Related products :

Catalog number Product name Quantity
EIAAB06276 CD177,CD177 antigen,HNA-2a,Homo sapiens,Human,Human neutrophil alloantigen 2a,NB1,NB1 glycoprotein,NB1 GP,Polycythemia rubra vera protein 1,PRV1,PRV-1,UNQ595_PRO1181
GWB-D55CD1 Polycythemia Rubra Vera 1; Cell Surface Receptor (PRV1 CD177) Mouse anti-Human Monoclonal (MEM-166) Antibody
GWB-D55CD1 Polycythemia Rubra Vera 1; Cell Surface Receptor (PRV1_CD177) Mouse anti-Human Monoclonal (MEM-166) Antibody
CD177_HUMAN ELISA Kit FOR CD177 antigen; organism: Human; gene name: CD177 96T
CSB-EL004886HU Human CD177 antigen(CD177) ELISA kit SpeciesHuman 96T
CSB-EL004886HU Human CD177 antigen(CD177) ELISA kit 96T
A6-314-T025 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 25 tests
A7-314-T025 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 25 tests
A7-314-T100 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 100 tests
1P-314-T100 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 100 tests
11-314-C025 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 0.025 mg
11-314-M001 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 1.0 mg
1F-314-T100 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 100 tests
11-314-C100 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 0.1 mg
1P-314-T025 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 25 tests
1A-314-T100 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 100 tests
PB-314-T100 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 100 tests
A6-314-T100 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 100 tests
1A-314-T025 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 25 tests
1F-314-T025 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 25 tests
PB-314-T025 Mouse Monoclonal to CD177 Antigen CD177 Isotype IgG1 Antigen CD177 Isotype IgG1 25 tests
CD177_MOUSE ELISA Kit FOR CD177 antigen; organism: Mouse; gene name: Cd177 96T
CSB-EL004886MO Mouse CD177 antigen(CD177) ELISA kit SpeciesMouse 96T
CSB-EL004886MO Mouse CD177 antigen(CD177) ELISA kit 96T
EIAAB06277 Cd177,CD177 antigen,Mouse,Mus musculus


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur