Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

CD44 antigen (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)

 CD44_RAT                Reviewed;         503 AA.
P26051; Q99021;
01-MAY-1992, integrated into UniProtKB/Swiss-Prot.
01-NOV-1997, sequence version 2.
20-JUN-2018, entry version 142.
RecName: Full=CD44 antigen;
AltName: Full=Extracellular matrix receptor III;
Short=ECMR-III;
AltName: Full=GP90 lymphocyte homing/adhesion receptor;
AltName: Full=HUTCH-I;
AltName: Full=Hermes antigen;
AltName: Full=Hyaluronate receptor;
AltName: Full=Phagocytic glycoprotein 1;
Short=PGP-1;
AltName: Full=Phagocytic glycoprotein I;
Short=PGP-I;
AltName: CD_antigen=CD44;
Flags: Precursor;
Name=Cd44;
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
STRAIN=BDIX; TISSUE=Pancreas;
PubMed=1707342; DOI=10.1016/0092-8674(91)90403-L;
Guenthert U., Hofmann M., Rudy W., Reber S., Zoeller M., Haussmann I.,
Matzku S., Wenzel A., Ponta H., Herrlich P.;
"A new variant of glycoprotein CD44 confers metastatic potential to
rat carcinoma cells.";
Cell 65:13-24(1991).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Stevens J.W., Midura R.J.;
Submitted (JAN-1996) to the EMBL/GenBank/DDBJ databases.
[3]
SULFATION AT TYR-288.
PubMed=9692903; DOI=10.1046/j.1432-1327.1998.2550074.x;
Sleeman J.P., Rahmsdorf U., Steffen A., Ponta H., Herrlich P.;
"CD44 variant exon v5 encodes a tyrosine that is sulphated.";
Eur. J. Biochem. 255:74-80(1998).
[4]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-447; THR-451 AND
SER-467, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
PubMed=22673903; DOI=10.1038/ncomms1871;
Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A.,
Lundby C., Olsen J.V.;
"Quantitative maps of protein phosphorylation sites across 14
different rat organs and tissues.";
Nat. Commun. 3:876-876(2012).
-!- FUNCTION: Receptor for hyaluronic acid (HA). Mediates cell-cell
and cell-matrix interactions through its affinity for HA, and
possibly also through its affinity for other ligands such as
osteopontin, collagens, and matrix metalloproteinases (MMPs).
Adhesion with HA plays an important role in cell migration, tumor
growth and progression. In cancer cells, may play an important
role in invadopodia formation. Also involved in lymphocyte
activation, recirculation and homing, and in hematopoiesis.
Receptor for LGALS9; the interaction enhances binding of SMAD3 to
the FOXP3 promoter, leading to up-regulation of FOXP3 expression
and increased induced regulatory T (iTreg) cell stability and
suppressive function. {ECO:0000250|UniProtKB:P15379,
ECO:0000250|UniProtKB:P16070}.
-!- SUBUNIT: Interacts with HA, as well as other glycosaminoglycans,
collagen, laminin, and fibronectin via its N-terminal segment.
Interacts with PKN2. Interacts with TIAM1 and TIAM2. Interacts
with UNC119. Interacts with PDPN (via extracellular domain); this
interaction is required for PDPN-mediated directional migration
and regulation of lamellipodia extension/stabilization during cell
spreading and migration. Interacts with RDX, EZR and MSN.
{ECO:0000250|UniProtKB:P15379, ECO:0000250|UniProtKB:P16070}.
-!- SUBCELLULAR LOCATION: Cell membrane
{ECO:0000250|UniProtKB:P15379}; Single-pass type I membrane
protein {ECO:0000250|UniProtKB:P15379}. Cell projection,
microvillus {ECO:0000250|UniProtKB:P15379}. Note=Colocalizes with
actin in membrane protrusions at wounding edges. Co-localizes with
RDX, EZR and MSN in microvilli. {ECO:0000250|UniProtKB:P15379}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Comment=Additional isoforms seem to exist.;
Name=2; Synonyms=Long, Meta-1;
IsoId=P26051-1; Sequence=Displayed;
Name=1; Synonyms=Short;
IsoId=P26051-2; Sequence=VSP_005330;
-!- DOMAIN: The lectin-like LINK domain is responsible for hyaluronan
binding. {ECO:0000250}.
-!- PTM: N-glycosylated. {ECO:0000250}.
-!- PTM: O-glycosylated; contains chondroitin sulfate glycans which
can be more or less sulfated. {ECO:0000250}.
-!- PTM: Phosphorylated; activation of PKC results in the
dephosphorylation of Ser-467 (constitutive phosphorylation site),
and the phosphorylation of Ser-433. {ECO:0000250}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; M61875; AAA53532.1; -; mRNA.
EMBL; M61874; AAA53534.1; -; mRNA.
EMBL; U52179; AAA97915.1; -; mRNA.
EMBL; U46957; AAA92920.1; -; mRNA.
PIR; B38745; B38745.
RefSeq; XP_006234693.1; XM_006234631.3.
UniGene; Rn.1120; -.
ProteinModelPortal; P26051; -.
SMR; P26051; -.
CORUM; P26051; -.
IntAct; P26051; 1.
iPTMnet; P26051; -.
PhosphoSitePlus; P26051; -.
PRIDE; P26051; -.
GeneID; 25406; -.
UCSC; RGD:2307; rat. [P26051-1]
CTD; 960; -.
RGD; 2307; Cd44.
HOVERGEN; HBG003850; -.
InParanoid; P26051; -.
PhylomeDB; P26051; -.
PRO; PR:P26051; -.
Proteomes; UP000002494; Unplaced.
GO; GO:0016324; C:apical plasma membrane; IDA:RGD.
GO; GO:0016323; C:basolateral plasma membrane; IDA:RGD.
GO; GO:0042995; C:cell projection; ISS:UniProtKB.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0031258; C:lamellipodium membrane; ISS:UniProtKB.
GO; GO:0005902; C:microvillus; ISS:UniProtKB.
GO; GO:0005634; C:nucleus; IDA:RGD.
GO; GO:0032991; C:protein-containing complex; IDA:RGD.
GO; GO:0005154; F:epidermal growth factor receptor binding; IPI:RGD.
GO; GO:0005540; F:hyaluronic acid binding; IEA:InterPro.
GO; GO:0051219; F:phosphoprotein binding; IPI:RGD.
GO; GO:0019901; F:protein kinase binding; IPI:RGD.
GO; GO:0001955; P:blood vessel maturation; IEP:RGD.
GO; GO:0007155; P:cell adhesion; IMP:RGD.
GO; GO:0016477; P:cell migration; IMP:RGD.
GO; GO:0006954; P:inflammatory response; IEP:RGD.
GO; GO:0034238; P:macrophage fusion; IMP:RGD.
GO; GO:0031175; P:neuron projection development; IMP:RGD.
GO; GO:0033031; P:positive regulation of neutrophil apoptotic process; IMP:RGD.
GO; GO:0001558; P:regulation of cell growth; IDA:RGD.
GO; GO:2000392; P:regulation of lamellipodium morphogenesis; ISS:UniProtKB.
GO; GO:0014070; P:response to organic cyclic compound; IEP:RGD.
GO; GO:0033189; P:response to vitamin A; IEP:RGD.
GO; GO:0044319; P:wound healing, spreading of cells; ISS:UniProtKB.
Gene3D; 3.10.100.10; -; 1.
InterPro; IPR016186; C-type_lectin-like/link_sf.
InterPro; IPR001231; CD44_antigen.
InterPro; IPR016187; CTDL_fold.
InterPro; IPR000538; Link_dom.
PANTHER; PTHR10225:SF6; PTHR10225:SF6; 1.
Pfam; PF00193; Xlink; 1.
PRINTS; PR00658; CD44.
PRINTS; PR01265; LINKMODULE.
SMART; SM00445; LINK; 1.
SUPFAM; SSF56436; SSF56436; 1.
PROSITE; PS01241; LINK_1; 1.
PROSITE; PS50963; LINK_2; 1.
1: Evidence at protein level;
Alternative splicing; Cell adhesion; Cell membrane; Cell projection;
Complete proteome; Disulfide bond; Glycoprotein; Membrane;
Phosphoprotein; Proteoglycan; Receptor; Reference proteome; Signal;
Sulfation; Transmembrane; Transmembrane helix.
SIGNAL 1 21
CHAIN 22 503 CD44 antigen.
/FTId=PRO_0000026691.
TOPO_DOM 22 410 Extracellular. {ECO:0000255}.
TRANSMEM 411 431 Helical. {ECO:0000255}.
TOPO_DOM 432 503 Cytoplasmic. {ECO:0000255}.
DOMAIN 35 124 Link. {ECO:0000255|PROSITE-
ProRule:PRU00323}.
REGION 228 410 Stem.
REGION 434 452 Required for interaction with EZR, MSN
and RDX and for co-localization to
microvilli.
{ECO:0000250|UniProtKB:P15379}.
COMPBIAS 154 162 Arg/Lys-rich (basic).
BINDING 44 44 Hyaluronan. {ECO:0000250}.
BINDING 81 81 Hyaluronan. {ECO:0000250}.
BINDING 82 82 Hyaluronan. {ECO:0000250}.
BINDING 108 108 Hyaluronan. {ECO:0000250}.
MOD_RES 288 288 Sulfotyrosine.
{ECO:0000269|PubMed:9692903}.
MOD_RES 433 433 Phosphoserine; by PKC.
{ECO:0000250|UniProtKB:P16070}.
MOD_RES 447 447 Phosphoserine.
{ECO:0000244|PubMed:22673903}.
MOD_RES 451 451 Phosphothreonine.
{ECO:0000244|PubMed:22673903}.
MOD_RES 458 458 Phosphoserine.
{ECO:0000250|UniProtKB:P15379}.
MOD_RES 467 467 Phosphoserine.
{ECO:0000244|PubMed:22673903}.
CARBOHYD 28 28 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 60 60 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 103 103 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 114 114 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 124 124 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 266 266 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 274 274 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 306 306 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 31 133 {ECO:0000255|PROSITE-ProRule:PRU00323}.
DISULFID 56 122 {ECO:0000255|PROSITE-ProRule:PRU00323}.
DISULFID 80 100 {ECO:0000255|PROSITE-ProRule:PRU00323}.
VAR_SEQ 224 385 IATTPWVSAHTKQNQERTQWNPIHSNPEVLLQTTTRMTDID
RNSTSAHGENWTQEPQPPFNNHEYQDEEETPHATSTTWADP
NSTTEEAATQKEKWFENEWQGKNPPTPSEDSHVTEGTTASA
HNNHPSQRMTTQSQEDVSWTDFFDPISHPMGQGHQTESK
-> SDGDSSMDPRGGFDTVTHGSELA (in isoform
1). {ECO:0000303|PubMed:1707342,
ECO:0000303|Ref.2}.
/FTId=VSP_005330.
CONFLICT 74 74 R -> S (in Ref. 2; AAA97915/AAA92920).
{ECO:0000305}.
SEQUENCE 503 AA; 55946 MW; FB489D009BD4EE22 CRC64;
MDKVWWHTAW GLLCLLQLSL AQQQIDLNIT CRYAGVFHVE KNGRYSISRT EAADLCEAFN
TTLPTMAQME LALRKGFETC RYGFIEGHVV IPRIHPNAIC AANNTGVYIL LASNTSHYDT
YCFNASAPLE EDCTSVTDLP NSFDGPVTIT IVNRDGTRYS KKGEYRTHQE DIDASNIIDE
DVSSGSTIEK STPEGYILHT DLPTSQPTGD RDDAFFIGST LATIATTPWV SAHTKQNQER
TQWNPIHSNP EVLLQTTTRM TDIDRNSTSA HGENWTQEPQ PPFNNHEYQD EEETPHATST
TWADPNSTTE EAATQKEKWF ENEWQGKNPP TPSEDSHVTE GTTASAHNNH PSQRMTTQSQ
EDVSWTDFFD PISHPMGQGH QTESKGHSSG NQDSGVTTTS GPARRPQIPE WLIILASLLA
LALILAVCIA VNSRRRCGQK KKLVINSGNG TVEDRKPSEL NGEASKSQEM VHLVNKEPTE
TPDQFMTADE TRNLQSVDMK IGV


Related products :

Catalog number Product name Quantity
E0670r ELISA Cd44,CD44 antigen,ECMR-III,Extracellular matrix receptor III,GP90 lymphocyte homing_adhesion receptor,Hermes antigen,HUTCH-I,Hyaluronate receptor,PGP-1,PGP-I,Phagocytic glycoprotein 1,Phagocytic 96T
U0670r CLIA Cd44,CD44 antigen,ECMR-III,Extracellular matrix receptor III,GP90 lymphocyte homing_adhesion receptor,Hermes antigen,HUTCH-I,Hyaluronate receptor,PGP-1,PGP-I,Phagocytic glycoprotein 1,Phagocytic 96T
E0670r ELISA kit Cd44,CD44 antigen,ECMR-III,Extracellular matrix receptor III,GP90 lymphocyte homing_adhesion receptor,Hermes antigen,HUTCH-I,Hyaluronate receptor,PGP-1,PGP-I,Phagocytic glycoprotein 1,Phago 96T
20-272-191858 CD44 - Mouse monoclonal [J-173] to CD44; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate r 0.1 mg
20-272-191874 CD44 - Mouse monoclonal [E1_2] to CD44; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate re 0.2 mg
20-272-190474 CD44 - Mouse monoclonal [A3D8] to CD44; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate re 50 TESTS
20-783-72396 MOUSE ANTI RAT CD44 RPE - H-CAM. pgp-1; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate re 100 TESTS
20-783-72753 MOUSE ANTI HUMAN CD44 - Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate receptor; Heparan 0.02 mg
20-783-72579 MOUSE ANTI LAPINE CD44 - Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate receptor; Heparan 2 ml
20-783-72668 MOUSE ANTI HUMAN CD44 Biotin - Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate receptor; H 0.1 mg
20-783-72670 MOUSE ANTI HUMAN CD44 RPE - Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate receptor; Hepa 100 TESTS
20-783-72669 MOUSE ANTI HUMAN CD44 FITC - Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate receptor; Hep 0.1 mg
20-783-72395 MOUSE ANTI RAT CD44 - H-CAM. pgp-1; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate recept 0.1 mg
20-783-70056 RAT ANTI CANINE CD44 - H-CAM. pgp-1; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate recep 0.25 mg
20-783-72707 MOUSE ANTI RAT CD44 - H-CAM. pgp-1; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate recept 2 ml
20-783-72394 MOUSE ANTI RAT CD44 FITC - H-CAM. pgp-1; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate r 0.5 mg
20-783-72393 MOUSE ANTI RAT CD44 FITC - H-CAM. pgp-1; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate r 0.1 mg
E0670b ELISA kit Bos taurus,Bovine,CD44,CD44 antigen,ECMR-III,Extracellular matrix receptor III,GP90 lymphocyte homing_adhesion receptor,Hermes antigen,HUTCH-I,Hyaluronate receptor,PGP-1,PGP-I,Phagocytic gl 96T
U0670b CLIA Bos taurus,Bovine,CD44,CD44 antigen,ECMR-III,Extracellular matrix receptor III,GP90 lymphocyte homing_adhesion receptor,Hermes antigen,HUTCH-I,Hyaluronate receptor,PGP-1,PGP-I,Phagocytic glycopro 96T
E0670b ELISA Bos taurus,Bovine,CD44,CD44 antigen,ECMR-III,Extracellular matrix receptor III,GP90 lymphocyte homing_adhesion receptor,Hermes antigen,HUTCH-I,Hyaluronate receptor,PGP-1,PGP-I,Phagocytic glycopr 96T
20-783-72671 MOUSE ANTI HUMAN CD44 Azide Free - Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronate recepto 1 mg
20-272-192349 CD44 - Mouse monoclonal [MEM - 85] to CD44; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronat 0.1 mg
20-272-191328 CD44 - Mouse monoclonal [156-3C11] to CD44; Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; Hyaluronat 0.5 ml
20-272-191850 CD44 (Biotin) - Rat monoclonal [IM7] to CD44 (Biotin); Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; 0.125 mg
20-272-191875 CD44 (FITC) - Mouse monoclonal [E1_2] to CD44 (FITC); Phagocytic glycoprotein I; PGP-1; HUTCH-I; Extracellular matrix receptor-III; ECMR-III; GP90 lymphocyte homing_adhesion receptor; Hermes antigen; 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur