Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

CD48 antigen (B-lymphocyte activation marker BLAST-1) (BCM1 surface antigen) (Leukocyte antigen MEM-102) (SLAM family member 2) (SLAMF2) (Signaling lymphocytic activation molecule 2) (TCT.1) (CD antigen CD48)

 CD48_HUMAN              Reviewed;         243 AA.
P09326; Q5U055; Q8MGR0;
01-JUL-1989, integrated into UniProtKB/Swiss-Prot.
01-NOV-1991, sequence version 2.
25-OCT-2017, entry version 192.
RecName: Full=CD48 antigen;
AltName: Full=B-lymphocyte activation marker BLAST-1;
AltName: Full=BCM1 surface antigen;
AltName: Full=Leukocyte antigen MEM-102;
AltName: Full=SLAM family member 2;
Short=SLAMF2;
AltName: Full=Signaling lymphocytic activation molecule 2;
AltName: Full=TCT.1;
AltName: CD_antigen=CD48;
Flags: Precursor;
Name=CD48; Synonyms=BCM1, BLAST1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=1999351; DOI=10.1007/BF00210824;
Vaughan H.A., Henning M.M., Purcell D.F.J., McKenzie I.F.C.,
Sandrin M.S.;
"The isolation of cDNA clones for CD48.";
Immunogenetics 33:113-117(1991).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=1999350; DOI=10.1007/BF00210823;
Korinek V., Stefanova I., Angelisova P., Hilbert I., Horejsi V.;
"The human leucocyte antigen CD48 (MEM-102) is closely related to the
activation marker Blast-1.";
Immunogenetics 33:108-112(1991).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=2828034;
Staunton D.E., Thorley-Lawson D.A.;
"Molecular cloning of the lymphocyte activation marker Blast-1.";
EMBO J. 6:3695-3701(1987).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=B-cell, and Pancreas;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-27.
PubMed=1847502; DOI=10.1128/MCB.11.3.1614;
Fisher R.C., Thorley-Lawson D.A.;
"Characterization of the Epstein-Barr virus-inducible gene encoding
the human leukocyte adhesion and activation antigen BLAST-1 (CD48).";
Mol. Cell. Biol. 11:1614-1623(1991).
[9]
PARTIAL PROTEIN SEQUENCE.
PubMed=1827826; DOI=10.1084/jem.173.6.1339;
del Porto P., Mami-Chouaib F., Bruneau J.-M., Jitsukawa S., Dumas J.,
Harnois M., Hercend T.;
"TCT.1, a target molecule for gamma/delta T cells, is encoded by an
immunoglobulin superfamily gene (Blast-1) located in the CD1 region of
human chromosome 1.";
J. Exp. Med. 173:1339-1344(1991).
[10]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-104; ASN-178 AND ASN-189.
TISSUE=Leukemic T-cell;
PubMed=19349973; DOI=10.1038/nbt.1532;
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M.,
Schiess R., Aebersold R., Watts J.D.;
"Mass-spectrometric identification and relative quantification of N-
linked cell surface glycoproteins.";
Nat. Biotechnol. 27:378-386(2009).
[11]
STRUCTURE BY NMR OF 24-140.
RIKEN structural genomics initiative (RSGI);
"Solution structure of the first Ig-like domain from human CD48
antigen.";
Submitted (AUG-2007) to the PDB data bank.
-!- FUNCTION: Ligand for CD2. Might facilitate interaction between
activated lymphocytes. Probably involved in regulating T-cell
activation.
-!- SUBUNIT: Interacts with CD244 in a heterophilic manner.
{ECO:0000250}.
-!- INTERACTION:
Q9BZW8:CD244; NbExp=4; IntAct=EBI-714770, EBI-1580565;
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Lipid-anchor,
GPI-anchor {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P09326-1; Sequence=Displayed;
Name=2;
IsoId=P09326-2; Sequence=VSP_055598, VSP_055599;
Note=No experimental confirmation available.;
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; M59904; AAA62834.1; -; mRNA.
EMBL; X06341; CAA29647.1; -; mRNA.
EMBL; M37766; AAA36211.1; -; mRNA.
EMBL; BT019813; AAV38616.1; -; mRNA.
EMBL; AL121985; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471121; EAW52705.1; -; Genomic_DNA.
EMBL; BC016182; AAH16182.1; -; mRNA.
EMBL; BC030224; AAH30224.1; -; mRNA.
EMBL; M63911; AAA35602.1; -; Genomic_DNA.
CCDS; CCDS1208.1; -. [P09326-1]
PIR; A53244; A53244.
RefSeq; NP_001769.2; NM_001778.3. [P09326-1]
UniGene; Hs.243564; -.
PDB; 2EDO; NMR; -; A=27-140.
PDBsum; 2EDO; -.
ProteinModelPortal; P09326; -.
SMR; P09326; -.
BioGrid; 107400; 6.
IntAct; P09326; 4.
MINT; MINT-1427578; -.
STRING; 9606.ENSP00000357025; -.
iPTMnet; P09326; -.
PhosphoSitePlus; P09326; -.
SwissPalm; P09326; -.
BioMuta; CD48; -.
DMDM; 114871; -.
EPD; P09326; -.
MaxQB; P09326; -.
PaxDb; P09326; -.
PeptideAtlas; P09326; -.
PRIDE; P09326; -.
TopDownProteomics; P09326-1; -. [P09326-1]
DNASU; 962; -.
Ensembl; ENST00000368045; ENSP00000357024; ENSG00000117091. [P09326-2]
Ensembl; ENST00000368046; ENSP00000357025; ENSG00000117091. [P09326-1]
GeneID; 962; -.
KEGG; hsa:962; -.
UCSC; uc001fwn.4; human. [P09326-1]
CTD; 962; -.
DisGeNET; 962; -.
EuPathDB; HostDB:ENSG00000117091.9; -.
GeneCards; CD48; -.
HGNC; HGNC:1683; CD48.
HPA; CAB002497; -.
HPA; HPA055146; -.
MIM; 109530; gene.
neXtProt; NX_P09326; -.
OpenTargets; ENSG00000117091; -.
PharmGKB; PA26223; -.
eggNOG; ENOG410J3RS; Eukaryota.
eggNOG; ENOG410ZR3T; LUCA.
GeneTree; ENSGT00510000049275; -.
HOGENOM; HOG000111487; -.
HOVERGEN; HBG004490; -.
InParanoid; P09326; -.
KO; K06479; -.
OMA; SSGVAWI; -.
PhylomeDB; P09326; -.
TreeFam; TF334964; -.
Reactome; R-HSA-202733; Cell surface interactions at the vascular wall.
EvolutionaryTrace; P09326; -.
GeneWiki; CD48; -.
GenomeRNAi; 962; -.
PRO; PR:P09326; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000117091; -.
CleanEx; HS_CD48; -.
ExpressionAtlas; P09326; baseline and differential.
Genevisible; P09326; HS.
GO; GO:0031225; C:anchored component of membrane; IEA:UniProtKB-KW.
GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0016020; C:membrane; IDA:UniProtKB.
GO; GO:0045121; C:membrane raft; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0004872; F:receptor activity; IEA:InterPro.
GO; GO:0006952; P:defense response; TAS:ProtInc.
GO; GO:0050900; P:leukocyte migration; TAS:Reactome.
GO; GO:0002819; P:regulation of adaptive immune response; IEA:InterPro.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR033548; CD48.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
InterPro; IPR013106; Ig_V-set.
PANTHER; PTHR12080:SF47; PTHR12080:SF47; 1.
Pfam; PF13895; Ig_2; 1.
Pfam; PF07686; V-set; 1.
SMART; SM00409; IG; 1.
SUPFAM; SSF48726; SSF48726; 2.
PROSITE; PS50835; IG_LIKE; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cell membrane; Complete proteome;
Direct protein sequencing; Disulfide bond; Glycoprotein; GPI-anchor;
Immunoglobulin domain; Lipoprotein; Membrane; Polymorphism;
Reference proteome; Repeat; Signal.
SIGNAL 1 26 {ECO:0000255}.
CHAIN 27 220 CD48 antigen.
/FTId=PRO_0000014881.
PROPEP 221 243 Removed in mature form. {ECO:0000250}.
/FTId=PRO_0000014882.
DOMAIN 29 127 Ig-like C2-type 1.
DOMAIN 132 212 Ig-like C2-type 2.
LIPID 220 220 GPI-anchor amidated serine.
{ECO:0000250}.
CARBOHYD 40 40 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 44 44 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 104 104 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:19349973}.
CARBOHYD 162 162 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 178 178 N-linked (GlcNAc...) asparagine;
atypical. {ECO:0000269|PubMed:19349973}.
CARBOHYD 189 189 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:19349973}.
DISULFID 154 196 {ECO:0000255|PROSITE-ProRule:PRU00114}.
VAR_SEQ 129 169 DPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDK
-> GESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTS
GQV (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_055598.
VAR_SEQ 170 243 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_055599.
VARIANT 102 102 E -> Q (in dbSNP:rs2295615).
/FTId=VAR_020082.
VARIANT 241 241 L -> S (in dbSNP:rs16832307).
/FTId=VAR_049909.
CONFLICT 2 2 C -> W (in Ref. 1; AAA62834).
{ECO:0000305}.
CONFLICT 66 66 I -> N (in Ref. 3; CAA29647).
{ECO:0000305}.
STRAND 34 36 {ECO:0000244|PDB:2EDO}.
STRAND 41 43 {ECO:0000244|PDB:2EDO}.
STRAND 51 61 {ECO:0000244|PDB:2EDO}.
STRAND 64 69 {ECO:0000244|PDB:2EDO}.
STRAND 74 76 {ECO:0000244|PDB:2EDO}.
TURN 80 84 {ECO:0000244|PDB:2EDO}.
TURN 89 91 {ECO:0000244|PDB:2EDO}.
STRAND 94 98 {ECO:0000244|PDB:2EDO}.
HELIX 101 103 {ECO:0000244|PDB:2EDO}.
STRAND 105 113 {ECO:0000244|PDB:2EDO}.
TURN 114 116 {ECO:0000244|PDB:2EDO}.
STRAND 117 120 {ECO:0000244|PDB:2EDO}.
STRAND 126 128 {ECO:0000244|PDB:2EDO}.
SEQUENCE 243 AA; 27683 MW; 9E46D76FC36A512C CRC64;
MCSRGWDSCL ALELLLLPLS LLVTSIQGHL VHMTVVSGSN VTLNISESLP ENYKQLTWFY
TFDQKIVEWD SRKSKYFESK FKGRVRLDPQ SGALYISKVQ KEDNSTYIMR VLKKTGNEQE
WKIKLQVLDP VPKPVIKIEK IEDMDDNCYL KLSCVIPGES VNYTWYGDKR PFPKELQNSV
LETTLMPHNY SRCYTCQVSN SVSSKNGTVC LSPPCTLARS FGVEWIASWL VVTVPTILGL
LLT


Related products :

Catalog number Product name Quantity
EIAAB06350 BCM1,BCM1 surface antigen,BLAST1,B-lymphocyte activation marker BLAST-1,CD48,CD48 antigen,Homo sapiens,Human,Leukocyte antigen MEM-102,TCT.1
EIAAB38625 CD84,Cell surface antigen MAX.3,Hly9-beta,Homo sapiens,Human,Leukocyte differentiation antigen CD84,Signaling lymphocytic activation molecule 5,SLAM family member 5,SLAMF5
EIAAB06349 Bcm-1,BCM1 surface antigen,BLAST-1,Cd48,CD48 antigen,HM48-1,Mouse,MRC OX-45 surface antigen,Mus musculus,sgp-60
EIAAB06351 Bcm-1,BCM1 surface antigen,BLAST-1,Cd48,CD48 antigen,MRC OX-45 surface antigen,Rat,Rattus norvegicus
EIAAB38624 Cd84,Leukocyte differentiation antigen CD84,Mouse,Mus musculus,Signaling lymphocytic activation molecule 5,SLAM family member 5,Slamf5
20-783-71526 MOUSE ANTI HUMAN CD84 - Signaling lymphocytic activation molecule 5; Leukocyte differentiation antigen CD84; CD84 antigen; Cell surface antigen MAX.3; Hly9-beta Monoclonal 0.2 mg
20-783-71529 MOUSE ANTI HUMAN CD84 RPE - Signaling lymphocytic activation molecule 5; Leukocyte differentiation antigen CD84; CD84 antigen; Cell surface antigen MAX.3; Hly9-beta Monoclonal 100 TESTS
20-783-71528 MOUSE ANTI HUMAN CD84 FITC - Signaling lymphocytic activation molecule 5; Leukocyte differentiation antigen CD84; CD84 antigen; Cell surface antigen MAX.3; Hly9-beta Monoclonal 0.1 mg
20-783-71527 MOUSE ANTI HUMAN CD84 Biotin - Signaling lymphocytic activation molecule 5; Leukocyte differentiation antigen CD84; CD84 antigen; Cell surface antigen MAX.3; Hly9-beta Monoclonal 0.1 mg
20-783-71530 MOUSE ANTI HUMAN CD84 Azide Free - Signaling lymphocytic activation molecule 5; Leukocyte differentiation antigen CD84; CD84 antigen; Cell surface antigen MAX.3; Hly9-beta Monoclonal 1 mg
EIAAB06374 Activation inducer molecule,AIM,BL-AC_P26,CD69,CLEC2C,C-type lectin domain family 2 member C,EA1,Early activation antigen CD69,Early T-cell activation antigen p60,GP32_28,Homo sapiens,Human,Leukocyte
50415-RP02 CD48 _ BCM1 _ SLAMF2 Antibody (Antigen Affinity Purified) 100
10797-RP04 CD48 _ BCM1 _ SLAMF2 Antibody (Antigen Affinity Purified) 100
E0086h ELISA CD62 antigen-like family member L,gp90-MEL,Homo sapiens,Human,LAM-1,LECAM1,Leukocyte adhesion molecule 1,Leukocyte surface antigen Leu-8,Leukocyte-endothelial cell adhesion molecule 1,LNHR,L-sel 96T
E0086h ELISA kit CD62 antigen-like family member L,gp90-MEL,Homo sapiens,Human,LAM-1,LECAM1,Leukocyte adhesion molecule 1,Leukocyte surface antigen Leu-8,Leukocyte-endothelial cell adhesion molecule 1,LNHR, 96T
U0086h CLIA CD62 antigen-like family member L,gp90-MEL,Homo sapiens,Human,LAM-1,LECAM1,Leukocyte adhesion molecule 1,Leukocyte surface antigen Leu-8,Leukocyte-endothelial cell adhesion molecule 1,LNHR,L-sele 96T
EIAAB06290 B-lymphocyte antigen CD20,B-lymphocyte surface antigen B1,Bp35,CD20,Homo sapiens,Human,Leukocyte surface antigen Leu-16,Membrane-spanning 4-domains subfamily A member 1,MS4A1
U0824m CLIA Activation B7-2 antigen,Cd86,Early T-cell costimulatory molecule 1,ETC-1,Mouse,Mus musculus,T-lymphocyte activation antigen CD86 96T
E0824m ELISA kit Activation B7-2 antigen,Cd86,Early T-cell costimulatory molecule 1,ETC-1,Mouse,Mus musculus,T-lymphocyte activation antigen CD86 96T
E0824m ELISA Activation B7-2 antigen,Cd86,Early T-cell costimulatory molecule 1,ETC-1,Mouse,Mus musculus,T-lymphocyte activation antigen CD86 96T
EIAAB38324 Bit,Bit,Brain Ig-like molecule with tyrosine-based activation motifs,CD172 antigen-like family member A,Inhibitory receptor SHPS-1,Mouse,mSIRP-alpha1,Mus musculus,Myd1,MyD-1 antigen,p84,Ptpns1,SHP sub
U2005h CLIA kit 4F2 cell-surface antigen heavy chain,4F2 heavy chain antigen,4F2hc,Homo sapiens,Human,Lymphocyte activation antigen 4F2 large subunit,MDU1,SLC3A2 96T
E2005h ELISA 4F2 cell-surface antigen heavy chain,4F2 heavy chain antigen,4F2hc,Homo sapiens,Human,Lymphocyte activation antigen 4F2 large subunit,MDU1,SLC3A2 96T
U2005h CLIA 4F2 cell-surface antigen heavy chain,4F2 heavy chain antigen,4F2hc,Homo sapiens,Human,Lymphocyte activation antigen 4F2 large subunit,MDU1,SLC3A2 96T
E2005h ELISA kit 4F2 cell-surface antigen heavy chain,4F2 heavy chain antigen,4F2hc,Homo sapiens,Human,Lymphocyte activation antigen 4F2 large subunit,MDU1,SLC3A2 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur