Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Calcium and integrin-binding family member 2 (Kinase-interacting protein 2) (KIP 2)

 CIB2_HUMAN              Reviewed;         187 AA.
O75838; B4DDF0; H0YM71; Q05BT6;
11-JAN-2001, integrated into UniProtKB/Swiss-Prot.
01-NOV-1998, sequence version 1.
28-MAR-2018, entry version 146.
RecName: Full=Calcium and integrin-binding family member 2;
AltName: Full=Kinase-interacting protein 2;
Short=KIP 2;
Name=CIB2; Synonyms=KIP2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Fetal brain;
PubMed=9931475; DOI=10.1016/S0167-4781(98)00253-X;
Seki N., Hattori A., Hayashi A., Kozuma S., Ohira M., Hori T.,
Saito T.;
"Structure, expression profile and chromosomal location of an isolog
of DNA-PKcs interacting protein (KIP) gene.";
Biochim. Biophys. Acta 1444:143-147(1999).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16572171; DOI=10.1038/nature04601;
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K.,
Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K.,
FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N.,
Abouelleil A., Arachchi H.M., Baradarani L., Birditt B., Bloom S.,
Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K.,
DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R.,
Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G.,
Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A.,
Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W.,
Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X.,
Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K.,
Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S.,
Nusbaum C.;
"Analysis of the DNA sequence and duplication history of human
chromosome 15.";
Nature 440:671-675(2006).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
TISSUE=Brain, and Skin;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
INTERACTION WITH ITGA2B AND ITGA7, CALCIUM-BINDING, AND
MAGNESIUM-BINDING.
PubMed=22779914; DOI=10.1139/o2012-021;
Huang H., Bogstie J.N., Vogel H.J.;
"Biophysical and structural studies of the human calcium- and
integrin-binding protein family: understanding their functional
similarities and differences.";
Biochem. Cell Biol. 90:646-656(2012).
[7]
VARIANTS DFNB48 SER-91; TRP-99 AND THR-123, VARIANT USH1J ASP-64,
FUNCTION, SUBUNIT, INTERACTION WITH WHRN AND MYO7A, AND TISSUE
SPECIFICITY.
PubMed=23023331; DOI=10.1038/ng.2426;
Riazuddin S., Belyantseva I.A., Giese A.P., Lee K., Indzhykulian A.A.,
Nandamuri S.P., Yousaf R., Sinha G.P., Lee S., Terrell D., Hegde R.S.,
Ali R.A., Anwar S., Andrade-Elizondo P.B., Sirmaci A., Parise L.V.,
Basit S., Wali A., Ayub M., Ansar M., Ahmad W., Khan S.N., Akram J.,
Tekin M., Riazuddin S., Cook T., Buschbeck E.K., Frolenkov G.I.,
Leal S.M., Friedman T.B., Ahmed Z.M.;
"Alterations of the CIB2 calcium- and integrin-binding protein cause
Usher syndrome type 1J and nonsyndromic deafness DFNB48.";
Nat. Genet. 44:1265-1271(2012).
[8]
VARIANT DFNB48 TRP-186, CHARACTERIZATION OF VARIANTS DFNB48 SER-91 AND
TRP-186, INTERACTION WITH WHRN, FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=26426422; DOI=10.1371/journal.pone.0133082;
Patel K., Giese A.P., Grossheim J.M., Hegde R.S., Hegde R.S.,
Delio M., Samanich J., Riazuddin S., Frolenkov G.I., Cai J.,
Ahmed Z.M., Morrow B.E.;
"A novel c-terminal CIB2 (calcium and integrin binding protein 2)
mutation associated with non-syndromic hearing loss in a hispanic
family.";
PLoS ONE 10:E0133082-E0133082(2015).
[9]
VARIANTS DFNB48 TRP-66 AND SER-91, CHARACTERIZATION OF VARIANTS DFNB48
TRP-66 AND SER-91, FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=26173970; DOI=10.1038/ejhg.2015.157;
Seco C.Z., Giese A.P., Shafique S., Schraders M., Oonk A.M.,
Grossheim M., Oostrik J., Strom T., Hegde R., van Wijk E.,
Frolenkov G.I., Azam M., Yntema H.G., Free R.H., Riazuddin S.,
Verheij J.B., Admiraal R.J., Qamar R., Ahmed Z.M., Kremer H.;
"Novel and recurrent CIB2 variants, associated with nonsyndromic
deafness, do not affect calcium buffering and localization in hair
cells.";
Eur. J. Hum. Genet. 24:542-549(2016).
-!- FUNCTION: Calcium-binding protein critical for proper
photoreceptor cell maintenance and function. Plays a role in
intracellular calcium homeostasis by decreasing ATP-induced
calcium release (PubMed:23023331, PubMed:26173970,
PubMed:26426422). May be involved in the mechanotransduction
process (By similarity). {ECO:0000250,
ECO:0000269|PubMed:23023331, ECO:0000269|PubMed:26173970,
ECO:0000269|PubMed:26426422}.
-!- SUBUNIT: Homodimer (PubMed:23023331). Interacts with WHRN and
MYO7A (PubMed:23023331, PubMed:26426422). Interacts with ITGA2B
(via C-terminus cytoplasmic tail region) and ITGA7 (via C-terminus
cytoplasmic tail region); the interactions are
stabilized/increased in a calcium and magnesium-dependent manner
(PubMed:22779914). {ECO:0000269|PubMed:22779914,
ECO:0000269|PubMed:23023331, ECO:0000269|PubMed:26426422}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9Z309}.
Cell projection, stereocilium {ECO:0000269|PubMed:26173970,
ECO:0000269|PubMed:26426422}. Photoreceptor inner segment
{ECO:0000250|UniProtKB:Q9Z309}. Cell projection, cilium,
photoreceptor outer segment {ECO:0000250|UniProtKB:Q9Z309}. Cell
membrane, sarcolemma {ECO:0000250|UniProtKB:Q9Z309}.
Note=Colocalized with ITGA7 at the myotendinous junctions (MTJ)
and at the neuromuscular junctions (NMJ) (By similarity).
Localizes in the cuticular plate along and at the tip of the
stereocilia of vestibular sensory hair cells (PubMed:26173970,
PubMed:26426422). {ECO:0000250|UniProtKB:Q9Z309,
ECO:0000269|PubMed:26173970, ECO:0000269|PubMed:26426422}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=O75838-1; Sequence=Displayed;
Name=2;
IsoId=O75838-2; Sequence=VSP_053864;
Note=No experimental confirmation available.;
Name=3;
IsoId=O75838-3; Sequence=VSP_053863;
Note=No experimental confirmation available.;
Name=4;
IsoId=O75838-4; Sequence=VSP_054777;
Note=No experimental confirmation available. Derived from EST
data.;
-!- TISSUE SPECIFICITY: Widely expressed (PubMed:23023331).
{ECO:0000269|PubMed:23023331}.
-!- DISEASE: Deafness, autosomal recessive, 48 (DFNB48) [MIM:609439]:
A form of non-syndromic sensorineural hearing loss. Sensorineural
deafness results from damage to the neural receptors of the inner
ear, the nerve pathways to the brain, or the area of the brain
that receives sound information. DFNB48 patients have prelingual
onset of severe to profound sensorineural hearing loss affecting
all frequencies. {ECO:0000269|PubMed:23023331,
ECO:0000269|PubMed:26173970, ECO:0000269|PubMed:26426422}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-!- DISEASE: Usher syndrome 1J (USH1J) [MIM:614869]: USH is a
genetically heterogeneous condition characterized by the
association of retinitis pigmentosa with sensorineural deafness.
Age at onset and differences in auditory and vestibular function
distinguish Usher syndrome type 1 (USH1), Usher syndrome type 2
(USH2) and Usher syndrome type 3 (USH3). USH1 is characterized by
profound congenital sensorineural deafness, absent vestibular
function and prepubertal onset of progressive retinitis pigmentosa
leading to blindness. {ECO:0000269|PubMed:23023331}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- MISCELLANEOUS: The binding of either calcium or magnesium
significantly increases the structural stability of the protein in
comparison to apo-CIB (calcium- and magnesium-free form)
(PubMed:22779914). {ECO:0000269|PubMed:22779914}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AB012955; BAA33584.1; -; mRNA.
EMBL; AK293167; BAG56711.1; -; mRNA.
EMBL; AC090260; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471136; EAW99183.1; -; Genomic_DNA.
EMBL; CH471136; EAW99184.1; -; Genomic_DNA.
EMBL; CH471136; EAW99186.1; -; Genomic_DNA.
EMBL; BC033108; AAH33108.1; -; mRNA.
EMBL; BC047381; AAH47381.1; -; mRNA.
CCDS; CCDS10296.1; -. [O75838-1]
CCDS; CCDS61722.1; -. [O75838-3]
CCDS; CCDS61723.1; -. [O75838-4]
RefSeq; NP_001258817.1; NM_001271888.1. [O75838-3]
RefSeq; NP_001258818.1; NM_001271889.1. [O75838-4]
RefSeq; NP_001288153.1; NM_001301224.1.
RefSeq; NP_006374.1; NM_006383.3. [O75838-1]
RefSeq; XP_005254183.1; XM_005254126.3. [O75838-2]
RefSeq; XP_006720437.1; XM_006720374.2. [O75838-3]
UniGene; Hs.129867; -.
ProteinModelPortal; O75838; -.
SMR; O75838; -.
BioGrid; 115773; 16.
STRING; 9606.ENSP00000258930; -.
iPTMnet; O75838; -.
PhosphoSitePlus; O75838; -.
PaxDb; O75838; -.
PeptideAtlas; O75838; -.
PRIDE; O75838; -.
DNASU; 10518; -.
Ensembl; ENST00000258930; ENSP00000258930; ENSG00000136425. [O75838-1]
Ensembl; ENST00000539011; ENSP00000442459; ENSG00000136425. [O75838-3]
Ensembl; ENST00000557846; ENSP00000453488; ENSG00000136425. [O75838-4]
GeneID; 10518; -.
KEGG; hsa:10518; -.
UCSC; uc002bdb.3; human. [O75838-1]
CTD; 10518; -.
DisGeNET; 10518; -.
EuPathDB; HostDB:ENSG00000136425.12; -.
GeneCards; CIB2; -.
GeneReviews; CIB2; -.
HGNC; HGNC:24579; CIB2.
HPA; HPA036697; -.
MalaCards; CIB2; -.
MIM; 605564; gene.
MIM; 609439; phenotype.
MIM; 614869; phenotype.
neXtProt; NX_O75838; -.
OpenTargets; ENSG00000136425; -.
Orphanet; 90636; Autosomal recessive non-syndromic sensorineural deafness type DFNB.
Orphanet; 231169; Usher syndrome type 1.
PharmGKB; PA134927274; -.
eggNOG; KOG0038; Eukaryota.
eggNOG; COG5126; LUCA.
GeneTree; ENSGT00860000133737; -.
HOGENOM; HOG000233019; -.
HOVERGEN; HBG107344; -.
InParanoid; O75838; -.
OMA; PDCKLPL; -.
OrthoDB; EOG091G0OJZ; -.
PhylomeDB; O75838; -.
TreeFam; TF313865; -.
GenomeRNAi; 10518; -.
PRO; PR:O75838; -.
Proteomes; UP000005640; Chromosome 15.
Bgee; ENSG00000136425; -.
CleanEx; HS_CIB2; -.
ExpressionAtlas; O75838; baseline and differential.
Genevisible; O75838; HS.
GO; GO:0072562; C:blood microparticle; HDA:UniProtKB.
GO; GO:0032437; C:cuticular plate; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; ISS:UniProtKB.
GO; GO:0005927; C:muscle tendon junction; IEA:Ensembl.
GO; GO:0031594; C:neuromuscular junction; IEA:Ensembl.
GO; GO:0001917; C:photoreceptor inner segment; ISS:UniProtKB.
GO; GO:0001750; C:photoreceptor outer segment; ISS:UniProtKB.
GO; GO:0042383; C:sarcolemma; IEA:UniProtKB-SubCell.
GO; GO:0032420; C:stereocilium; IDA:UniProtKB.
GO; GO:0005509; F:calcium ion binding; IDA:UniProtKB.
GO; GO:0005178; F:integrin binding; IEA:Ensembl.
GO; GO:0000287; F:magnesium ion binding; IDA:UniProtKB.
GO; GO:0042803; F:protein homodimerization activity; IDA:UniProtKB.
GO; GO:0055074; P:calcium ion homeostasis; ISS:UniProtKB.
GO; GO:0071318; P:cellular response to ATP; IDA:UniProtKB.
GO; GO:0045494; P:photoreceptor cell maintenance; ISS:UniProtKB.
GO; GO:0007204; P:positive regulation of cytosolic calcium ion concentration; IDA:UniProtKB.
CDD; cd00051; EFh; 1.
InterPro; IPR011992; EF-hand-dom_pair.
InterPro; IPR018247; EF_Hand_1_Ca_BS.
InterPro; IPR002048; EF_hand_dom.
Pfam; PF13499; EF-hand_7; 1.
SMART; SM00054; EFh; 2.
SUPFAM; SSF47473; SSF47473; 1.
PROSITE; PS00018; EF_HAND_1; 2.
PROSITE; PS50222; EF_HAND_2; 3.
1: Evidence at protein level;
Alternative splicing; Calcium; Cell membrane; Cell projection; Cilium;
Complete proteome; Cytoplasm; Deafness; Disease mutation; Magnesium;
Membrane; Metal-binding; Non-syndromic deafness; Reference proteome;
Repeat; Retinitis pigmentosa; Usher syndrome.
CHAIN 1 187 Calcium and integrin-binding family
member 2.
/FTId=PRO_0000073534.
DOMAIN 66 101 EF-hand 1. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
DOMAIN 103 138 EF-hand 2. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
DOMAIN 144 179 EF-hand 3. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
CA_BIND 116 127 1. {ECO:0000305}.
CA_BIND 157 168 2. {ECO:0000305}.
VAR_SEQ 1 43 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_053863.
VAR_SEQ 18 66 Missing (in isoform 4). {ECO:0000305}.
/FTId=VSP_054777.
VAR_SEQ 181 187 STFHIRI -> RCCHYRGRAWAGQSRAGRDVGAEAPITRYL
(in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_053864.
VARIANT 64 64 E -> D (in USH1J; dbSNP:rs145415848).
{ECO:0000269|PubMed:23023331}.
/FTId=VAR_069086.
VARIANT 66 66 R -> W (in DFNB48; unknown pathological
significance; no loss on localization to
stereocilia; does not affect ATP-induced
calcium release; dbSNP:rs780168150).
{ECO:0000269|PubMed:26173970}.
/FTId=VAR_074552.
VARIANT 91 91 F -> S (in DFNB48; no loss on
localization to stereocilia; does not
affect ATP-induced calcium release;;
dbSNP:rs397515411).
{ECO:0000269|PubMed:23023331,
ECO:0000269|PubMed:26173970,
ECO:0000269|PubMed:26426422}.
/FTId=VAR_069087.
VARIANT 99 99 C -> W (in DFNB48; inhibits the ability
to decrease ATP-induced calcium release;
dbSNP:rs370965183).
{ECO:0000269|PubMed:23023331}.
/FTId=VAR_069088.
VARIANT 123 123 I -> T (in DFNB48; stimulates the ability
to decrease ATP-induced calcium release;
dbSNP:rs397515412).
{ECO:0000269|PubMed:23023331}.
/FTId=VAR_069089.
VARIANT 186 186 R -> W (in DFNB48; does not affect the
localization in the cuticular plate or to
the tip of stereocilia; inhibits the
ability to decrease ATP-induced calcium
release; does not affect binding with
WHRN; dbSNP:rs370359511).
{ECO:0000269|PubMed:26426422}.
/FTId=VAR_077559.
SEQUENCE 187 AA; 21644 MW; D51F6C25AD381BEF CRC64;
MGNKQTIFTE EQLDNYQDCT FFNKKDILKL HSRFYELAPN LVPMDYRKSP IVHVPMSLII
QMPELRENPF KERIVAAFSE DGEGNLTFND FVDMFSVLCE SAPRELKANY AFKIYDFNTD
NFICKEDLEL TLARLTKSEL DEEEVVLVCD KVIEEADLDG DGKLGFADFE DMIAKAPDFL
STFHIRI


Related products :

Catalog number Product name Quantity
EIAAB07392 Calcium and integrin-binding family member 2,Cib2,Kinase-interacting protein 2,KIP 2,Kip2,Mouse,Mus musculus
EIAAB07393 Calcium and integrin-binding family member 3,CIB3,Homo sapiens,Human,Kinase-interacting protein 3,KIP 3,KIP3
EIAAB07390 Calcium and integrin-binding family member 2,CIB2,Homo sapiens,Human,Kinase-interacting protein 2,KIP 2,KIP2
E1394h ELISA Calcium- and integrin-binding protein,Calcium and integrin-binding protein 1,Calmyrin,CIB,CIB,CIB1,CIBP,DNA-PKcs-interacting protein,Homo sapiens,Human,Kinase-interacting protein,KIP,KIP,PRKDCIP 96T
U1394h CLIA Calcium- and integrin-binding protein,Calcium and integrin-binding protein 1,Calmyrin,CIB,CIB,CIB1,CIBP,DNA-PKcs-interacting protein,Homo sapiens,Human,Kinase-interacting protein,KIP,KIP,PRKDCIP, 96T
E1394h ELISA kit Calcium- and integrin-binding protein,Calcium and integrin-binding protein 1,Calmyrin,CIB,CIB,CIB1,CIBP,DNA-PKcs-interacting protein,Homo sapiens,Human,Kinase-interacting protein,KIP,KIP,PR 96T
20-372-60089 calcium and integrin binding family member 2. mRNA (cDNA clone MGC 48487 IMAGE 5287072). complete cds - Mouse monoclonal anti-human CIB2 antibody; Kinase-interacting protein 2; KIP 2 Monoclonal 0.1 mg
EIAAB26847 Amyloid beta A4 protein-binding family A member 2-binding protein,APBA2BP,Homo sapiens,Human,NECAB3,Nek2-interacting protein 1,Neuronal calcium-binding protein 3,NIP1,N-terminal EF-hand calcium-bindin
10-288-21983F Calcium and integrin-binding protein 1 - Calmyrin; DNA-PKcs-interacting protein; Kinase-interacting protein; KIP; CIB; SNK-interacting protein 2-28; SIP2-28 0.1 mg
10-288-21983F Calcium and integrin-binding protein 1 - Calmyrin; DNA-PKcs-interacting protein; Kinase-interacting protein; KIP; CIB; SNK-interacting protein 2-28; SIP2-28 0.05 mg
E1394m ELISA kit Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Mouse,Mus musculus,Prkdcip 96T
E1394m ELISA Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Mouse,Mus musculus,Prkdcip 96T
U1394r CLIA Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Prkdcip,Rat,Rattus norvegicus 96T
E1394r ELISA kit Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Prkdcip,Rat,Rattus norvegicus 96T
E1394r ELISA Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Prkdcip,Rat,Rattus norvegicus 96T
U1394m CLIA Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Mouse,Mus musculus,Prkdcip 96T
CIC CIB3 Gene calcium and integrin binding family member 3
CIB4 CIB2 Gene calcium and integrin binding family member 2
CSB-EL005427RA Rat Calcium and integrin-binding family member 2(CIB2) ELISA kit 96T
CIDEA CIB4 Gene calcium and integrin binding family member 4
CIB2_HUMAN Human ELISA Kit FOR Calcium and integrin-binding family member 2 96T
GWB-6EFFE7 Calcium and integrin binding family member 2 (CIB2), Antibody
E1053Rb Mouse ELISA Kit FOR Calcium and integrin-binding family member 3 96T
CSB-EL005429HU Human Calcium and integrin-binding family member 4(CIB4) ELISA kit 96T
abx111300 Polyclonal Rabbit Calcium And Integrin Binding Family Member 4 Antibody 50 μl


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur