Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Calcium-binding mitochondrial carrier protein SCaMC-3 (Mitochondrial ATP-Mg/Pi carrier protein 2) (Mitochondrial Ca(2 )-dependent solute carrier protein 2) (Small calcium-binding mitochondrial carrier protein 3) (Solute carrier family 25 member 23)

 SCMC3_HUMAN             Reviewed;         468 AA.
Q9BV35; B4DGB6; Q4LBC2; Q705K3; Q86Y43; Q8N2N4; Q96NQ4;
05-FEB-2008, integrated into UniProtKB/Swiss-Prot.
05-FEB-2008, sequence version 2.
25-APR-2018, entry version 143.
RecName: Full=Calcium-binding mitochondrial carrier protein SCaMC-3;
AltName: Full=Mitochondrial ATP-Mg/Pi carrier protein 2;
AltName: Full=Mitochondrial Ca(2+)-dependent solute carrier protein 2;
AltName: Full=Small calcium-binding mitochondrial carrier protein 3;
AltName: Full=Solute carrier family 25 member 23;
Name=SLC25A23; Synonyms=APC2, MCSC2, SCAMC3;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, AND
TISSUE SPECIFICITY.
PubMed=15054102; DOI=10.1074/jbc.M401417200;
del Arco A., Satrustegui J.;
"Identification of a novel human subfamily of mitochondrial carriers
with calcium-binding domains.";
J. Biol. Chem. 279:24701-24713(2004).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, BIOPHYSICOCHEMICAL
PROPERTIES, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
TISSUE=Brain;
PubMed=15123600; DOI=10.1074/jbc.M400445200;
Fiermonte G., De Leonardis F., Todisco S., Palmieri L., Lasorsa F.M.,
Palmieri F.;
"Identification of the mitochondrial ATP-Mg/Pi transporter. Bacterial
expression, reconstitution, functional characterization, and tissue
distribution.";
J. Biol. Chem. 279:30722-30730(2004).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION,
CALCIUM-BINDING, AND TISSUE SPECIFICITY.
PubMed=15716113; DOI=10.1016/j.gene.2004.11.028;
Bassi M.T., Manzoni M., Bresciani R., Pizzo M.T., Della Monica A.,
Barlati S., Monti E., Borsani G.;
"Cellular expression and alternative splicing of SLC25A23, a member of
the mitochondrial Ca2+-dependent solute carrier gene family.";
Gene 345:173-182(2005).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Amygdala, Cerebellum, and Embryo;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Eye;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [MRNA] OF 413-468 (ISOFORM 4), AND ALTERNATIVE
SPLICING.
PubMed=15801905; DOI=10.1042/BJ20050283;
Del Arco A.;
"Novel variants of human SCaMC-3, an isoform of the ATP-Mg/P(i)
mitochondrial carrier, generated by alternative splicing from 3'-
flanking transposable elements.";
Biochem. J. 389:647-655(2005).
[8]
FUNCTION, INTERACTION WITH MCU AND MICU1, AND MUTAGENESIS OF ASP-22;
GLU-33; ASP-90 AND GLU-101.
PubMed=24430870; DOI=10.1091/mbc.E13-08-0502;
Hoffman N.E., Chandramoorthy H.C., Shanmughapriya S., Zhang X.Q.,
Vallem S., Doonan P.J., Malliankaraman K., Guo S., Rajan S.,
Elrod J.W., Koch W.J., Cheung J.Y., Madesh M.;
"SLC25A23 augments mitochondrial Ca(2+) uptake, interacts with MCU,
and induces oxidative stress-mediated cell death.";
Mol. Biol. Cell 25:936-947(2014).
-!- FUNCTION: Calcium-dependent mitochondrial solute carrier.
Mitochondrial solute carriers shuttle metabolites, nucleotides,
and cofactors through the mitochondrial inner membrane
(PubMed:15123600). May act as a ATP-Mg/Pi exchanger that mediates
the transport of Mg-ATP in exchange for phosphate, catalyzing the
net uptake or efflux of adenine nucleotides into or from the
mitochondria (PubMed:15123600). Acts as a regulator of
mitochondrial calcium uptake via interaction with MCU and MICU1
(PubMed:24430870). {ECO:0000269|PubMed:15123600,
ECO:0000269|PubMed:24430870}.
-!- BIOPHYSICOCHEMICAL PROPERTIES:
Kinetic parameters:
KM=1.3 mM for AMP {ECO:0000269|PubMed:15123600};
KM=0.54 mM for ADP {ECO:0000269|PubMed:15123600};
KM=0.31 mM for ATP {ECO:0000269|PubMed:15123600};
KM=0.22 mM for ATP-Mg {ECO:0000269|PubMed:15123600};
KM=1.4 mM for Pi {ECO:0000269|PubMed:15123600};
Vmax=68 umol/min/g enzyme with AMP as substrate
{ECO:0000269|PubMed:15123600};
Vmax=73 umol/min/g enzyme with ADP as substrate
{ECO:0000269|PubMed:15123600};
Vmax=65 umol/min/g enzyme with ATP as substrate
{ECO:0000269|PubMed:15123600};
Vmax=79 umol/min/g enzyme with ATP-Mg as substrate
{ECO:0000269|PubMed:15123600};
Vmax=70 umol/min/g enzyme with Pi as substrate
{ECO:0000269|PubMed:15123600};
-!- SUBUNIT: Interacts with MCU (PubMed:24430870). Interacts with
MICU1 (PubMed:24430870). {ECO:0000269|PubMed:24430870}.
-!- INTERACTION:
Q92624:APPBP2; NbExp=3; IntAct=EBI-2933255, EBI-743771;
-!- SUBCELLULAR LOCATION: Mitochondrion inner membrane
{ECO:0000269|PubMed:15054102, ECO:0000269|PubMed:15123600,
ECO:0000269|PubMed:15716113}; Multi-pass membrane protein
{ECO:0000269|PubMed:15054102, ECO:0000269|PubMed:15123600,
ECO:0000269|PubMed:15716113}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=SCaMC-3a;
IsoId=Q9BV35-1; Sequence=Displayed;
Name=2; Synonyms=SCaMC-3b;
IsoId=Q9BV35-2; Sequence=VSP_031075;
Name=3; Synonyms=SCaMC-3c;
IsoId=Q9BV35-3; Sequence=VSP_031074, VSP_031076;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=4; Synonyms=SCaMC-3d;
IsoId=Q9BV35-4; Sequence=VSP_031076;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Present in various cell lines (at protein
level). Expressed at low levels in most tissues examined, with
highest expression in brain, skeletal muscle and pancreas.
{ECO:0000269|PubMed:15054102, ECO:0000269|PubMed:15123600,
ECO:0000269|PubMed:15716113}.
-!- SIMILARITY: Belongs to the mitochondrial carrier (TC 2.A.29)
family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAB70825.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Sequence=BAC11071.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AJ619988; CAF04494.1; -; mRNA.
EMBL; AJ619962; CAF04059.1; -; mRNA.
EMBL; AJ512835; CAD55563.1; -; mRNA.
EMBL; AY750170; AAU95077.1; -; mRNA.
EMBL; AK054901; BAB70825.1; ALT_INIT; mRNA.
EMBL; AK074579; BAC11071.1; ALT_INIT; mRNA.
EMBL; AK294514; BAG57727.1; -; mRNA.
EMBL; CH471139; EAW69087.1; -; Genomic_DNA.
EMBL; CH471139; EAW69089.1; -; Genomic_DNA.
EMBL; BC001656; AAH01656.1; -; mRNA.
EMBL; AJ879082; CAI51684.1; -; mRNA.
EMBL; AJ879083; CAI51685.1; -; mRNA.
CCDS; CCDS32882.1; -. [Q9BV35-1]
RefSeq; NP_077008.2; NM_024103.2. [Q9BV35-1]
UniGene; Hs.356231; -.
UniGene; Hs.732434; -.
ProteinModelPortal; Q9BV35; -.
SMR; Q9BV35; -.
BioGrid; 122533; 21.
IntAct; Q9BV35; 2.
TCDB; 2.A.29.23.5; the mitochondrial carrier (mc) family.
iPTMnet; Q9BV35; -.
PhosphoSitePlus; Q9BV35; -.
BioMuta; SLC25A23; -.
DMDM; 167016556; -.
EPD; Q9BV35; -.
MaxQB; Q9BV35; -.
PaxDb; Q9BV35; -.
PeptideAtlas; Q9BV35; -.
PRIDE; Q9BV35; -.
DNASU; 79085; -.
Ensembl; ENST00000264088; ENSP00000264088; ENSG00000125648. [Q9BV35-3]
Ensembl; ENST00000301454; ENSP00000301454; ENSG00000125648. [Q9BV35-1]
Ensembl; ENST00000334510; ENSP00000334537; ENSG00000125648. [Q9BV35-2]
GeneID; 79085; -.
KEGG; hsa:79085; -.
UCSC; uc002mex.2; human. [Q9BV35-1]
CTD; 79085; -.
EuPathDB; HostDB:ENSG00000125648.14; -.
GeneCards; SLC25A23; -.
H-InvDB; HIX0014698; -.
HGNC; HGNC:19375; SLC25A23.
HPA; HPA009675; -.
HPA; HPA050883; -.
MIM; 608746; gene.
neXtProt; NX_Q9BV35; -.
OpenTargets; ENSG00000125648; -.
PharmGKB; PA134932456; -.
eggNOG; KOG0036; Eukaryota.
eggNOG; ENOG410XQ4P; LUCA.
GeneTree; ENSGT00880000137904; -.
HOVERGEN; HBG108464; -.
InParanoid; Q9BV35; -.
KO; K14684; -.
OrthoDB; EOG091G0C8S; -.
PhylomeDB; Q9BV35; -.
TreeFam; TF313492; -.
GenomeRNAi; 79085; -.
PRO; PR:Q9BV35; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000125648; -.
CleanEx; HS_APC2; -.
CleanEx; HS_SLC25A23; -.
ExpressionAtlas; Q9BV35; baseline and differential.
Genevisible; Q9BV35; HS.
GO; GO:0016021; C:integral component of membrane; IBA:GO_Central.
GO; GO:0005743; C:mitochondrial inner membrane; IBA:GO_Central.
GO; GO:0005739; C:mitochondrion; IDA:HPA.
GO; GO:0015217; F:ADP transmembrane transporter activity; IBA:GO_Central.
GO; GO:0005347; F:ATP transmembrane transporter activity; IBA:GO_Central.
GO; GO:0005509; F:calcium ion binding; IEA:InterPro.
GO; GO:0036444; P:calcium import into the mitochondrion; IMP:UniProtKB.
GO; GO:0071277; P:cellular response to calcium ion; IEA:Ensembl.
GO; GO:0006851; P:mitochondrial calcium ion transmembrane transport; IMP:UniProtKB.
GO; GO:0006839; P:mitochondrial transport; IBA:GO_Central.
GO; GO:0043457; P:regulation of cellular respiration; IEA:Ensembl.
GO; GO:0002082; P:regulation of oxidative phosphorylation; IEA:Ensembl.
GO; GO:0051282; P:regulation of sequestering of calcium ion; IEA:Ensembl.
GO; GO:0097274; P:urea homeostasis; IEA:Ensembl.
CDD; cd00051; EFh; 1.
Gene3D; 1.50.40.10; -; 1.
InterPro; IPR011992; EF-hand-dom_pair.
InterPro; IPR018247; EF_Hand_1_Ca_BS.
InterPro; IPR002048; EF_hand_dom.
InterPro; IPR002067; Mit_carrier.
InterPro; IPR018108; Mitochondrial_sb/sol_carrier.
InterPro; IPR023395; Mt_carrier_dom_sf.
Pfam; PF13202; EF-hand_5; 1.
Pfam; PF13499; EF-hand_7; 1.
Pfam; PF00153; Mito_carr; 3.
PRINTS; PR00926; MITOCARRIER.
SMART; SM00054; EFh; 3.
SUPFAM; SSF103506; SSF103506; 1.
SUPFAM; SSF47473; SSF47473; 1.
PROSITE; PS00018; EF_HAND_1; 2.
PROSITE; PS50222; EF_HAND_2; 3.
PROSITE; PS50920; SOLCAR; 3.
1: Evidence at protein level;
Alternative splicing; Calcium; Complete proteome; Membrane;
Metal-binding; Mitochondrion; Mitochondrion inner membrane;
Reference proteome; Repeat; Transmembrane; Transmembrane helix;
Transport.
CHAIN 1 468 Calcium-binding mitochondrial carrier
protein SCaMC-3.
/FTId=PRO_0000317609.
TOPO_DOM 1 188 Mitochondrial intermembrane.
{ECO:0000255}.
TRANSMEM 189 206 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 207 243 Mitochondrial matrix. {ECO:0000255}.
TRANSMEM 244 263 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 264 286 Mitochondrial intermembrane.
{ECO:0000255}.
TRANSMEM 287 300 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 301 336 Mitochondrial matrix. {ECO:0000255}.
TRANSMEM 337 356 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 357 379 Mitochondrial intermembrane.
{ECO:0000255}.
TRANSMEM 380 397 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 398 436 Mitochondrial matrix. {ECO:0000255}.
TRANSMEM 437 456 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 457 468 Mitochondrial intermembrane.
{ECO:0000255}.
DOMAIN 9 44 EF-hand 1. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
DOMAIN 77 112 EF-hand 2. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
DOMAIN 113 148 EF-hand 3. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
REPEAT 183 269 Solcar 1.
REPEAT 277 362 Solcar 2.
REPEAT 374 462 Solcar 3.
CA_BIND 22 33 1. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
CA_BIND 90 101 2. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
VAR_SEQ 161 161 T -> TLSSAGFSAWIKDSTAEQNRSKTTVLARRSGSHLKS
QHFGRPKWADHE (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_031074.
VAR_SEQ 408 468 ASIEGGPQLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIPA
VSISYVVYENMKQALGVTSR -> DVSVYKTDTVPTLIELT
GRRGRKMLNKSFWN (in isoform 2).
{ECO:0000303|PubMed:15716113}.
/FTId=VSP_031075.
VAR_SEQ 408 468 ASIEGGPQLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIPA
VSISYVVYENMKQALGVTSR -> GWSTVARFQITATSAFQ
VQAILLPQPPE (in isoform 3 and isoform 4).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:15801905}.
/FTId=VSP_031076.
MUTAGEN 22 22 D->A: Abolishes the ability to regulate
mitochondrial calcium uptake; when
associated with K-33; A-90 and K-101.
{ECO:0000269|PubMed:24430870}.
MUTAGEN 33 33 E->K: Abolishes the ability to regulate
mitochondrial calcium uptake; when
associated with A-22; A-90 and K-101.
{ECO:0000269|PubMed:24430870}.
MUTAGEN 90 90 D->A: Abolishes the ability to regulate
mitochondrial calcium uptake; when
associated with A-22; K-33 and K-101.
{ECO:0000269|PubMed:24430870}.
MUTAGEN 101 101 E->K: Abolishes the ability to regulate
mitochondrial calcium uptake; when
associated with A-22; K-33 and A-90.
{ECO:0000269|PubMed:24430870}.
SEQUENCE 468 AA; 52378 MW; B2D66A4665C27174 CRC64;
MRGSPGDAER RQRWGRLFEE LDSNKDGRVD VHELRQGLAR LGGGNPDPGA QQGISSEGDA
DPDGGLDLEE FSRYLQEREQ RLLLMFHSLD RNQDGHIDVS EIQQSFRALG ISISLEQAEK
ILHSMDRDGT MTIDWQEWRD HFLLHSLENV EDVLYFWKHS TVLDIGECLT VPDEFSKQEK
LTGMWWKQLV AGAVAGAVSR TGTAPLDRLK VFMQVHASKT NRLNILGGLR SMVLEGGIRS
LWRGNGINVL KIAPESAIKF MAYEQIKRAI LGQQETLHVQ ERFVAGSLAG ATAQTIIYPM
EVLKTRLTLR RTGQYKGLLD CARRILEREG PRAFYRGYLP NVLGIIPYAG IDLAVYETLK
NWWLQQYSHD SADPGILVLL ACGTISSTCG QIASYPLALV RTRMQAQASI EGGPQLSMLG
LLRHILSQEG MRGLYRGIAP NFMKVIPAVS ISYVVYENMK QALGVTSR


Related products :

Catalog number Product name Quantity
EIAAB37566 Calcium-binding mitochondrial carrier protein SCaMC-2,Kiaa1896,Mouse,Mus musculus,Scamc2,Slc25a25,Small calcium-binding mitochondrial carrier protein 2,Solute carrier family 25 member 25
EIAAB37560 Calcium-binding mitochondrial carrier protein SCaMC-1,Mouse,Mus musculus,Scamc1,Slc25a24,Small calcium-binding mitochondrial carrier protein 1,Solute carrier family 25 member 24
EIAAB37564 Bos taurus,Bovine,Calcium-binding mitochondrial carrier protein SCaMC-2,SCAMC2,SLC25A25,Small calcium-binding mitochondrial carrier protein 2,Solute carrier family 25 member 25
EIAAB37567 Calcium-binding mitochondrial carrier protein SCaMC-3,Mouse,Mus musculus,Scamc3,Slc25a23,Small calcium-binding mitochondrial carrier protein 3,Solute carrier family 25 member 23
EIAAB37562 Bos taurus,Bovine,Calcium-binding mitochondrial carrier protein SCaMC-1,SCAMC1,SLC25A24,Small calcium-binding mitochondrial carrier protein 1,Solute carrier family 25 member 24
EIAAB37559 Calcium-binding mitochondrial carrier protein SCaMC-1,EFINAL,Oryctolagus cuniculus,Peroxisomal Ca(2+)-dependent solute carrier,Rabbit,SCAMC1,SLC25A24,Small calcium-binding mitochondrial carrier protei
EIAAB37561 APC1,Calcium-binding mitochondrial carrier protein SCaMC-1,Homo sapiens,Human,MCSC1,Mitochondrial ATP-Mg_Pi carrier protein 1,Mitochondrial Ca(2+)-dependent solute carrier protein 1,SCAMC1,SLC25A24,Sm
EIAAB37565 APC3,Calcium-binding mitochondrial carrier protein SCaMC-2,Homo sapiens,Human,KIAA1896,MCSC3,Mitochondrial ATP-Mg_Pi carrier protein 3,Mitochondrial Ca(2+)-dependent solute carrier protein 3,SCAMC2,SL
EIAAB37568 APC2,Calcium-binding mitochondrial carrier protein SCaMC-3,Homo sapiens,Human,MCSC2,Mitochondrial ATP-Mg_Pi carrier protein 2,Mitochondrial Ca(2+)-dependent solute carrier protein 2,SCAMC3,SLC25A23,Sm
EIAAB37563 Calcium-binding mitochondrial carrier protein SCaMC-2,Mcsc,Mitochondrial ATP-Mg_Pi carrier protein,Pcscl,Peroxisomal Ca(2+)-dependent solute carrier-like protein,Rat,Rattus norvegicus,Scamc2,Slc25a25,
EIAAB08043 Aralar1,Calcium-binding mitochondrial carrier protein Aralar1,Mitochondrial aspartate glutamate carrier 1,Mouse,Mus musculus,Slc25a12,Solute carrier family 25 member 12
EIAAB08044 ARALAR1,Calcium-binding mitochondrial carrier protein Aralar1,Homo sapiens,Human,Mitochondrial aspartate glutamate carrier 1,SLC25A12,Solute carrier family 25 member 12
EIAAB08046 Aralar2,Calcium-binding mitochondrial carrier protein Aralar2,Citrin,Mitochondrial aspartate glutamate carrier 2,Mouse,Mus musculus,Slc25a13,Solute carrier family 25 member 13
EIAAB08045 ARALAR2,Calcium-binding mitochondrial carrier protein Aralar2,Citrin,Homo sapiens,Human,Mitochondrial aspartate glutamate carrier 2,SLC25A13,Solute carrier family 25 member 13
EIAAB45188 Bmcp1,BMCP-1,Brain mitochondrial carrier protein 1,Mitochondrial uncoupling protein 5,Mouse,Mus musculus,Slc25a14,Solute carrier family 25 member 14,UCP 5,Ucp5
EIAAB45189 BMCP1,BMCP-1,Brain mitochondrial carrier protein 1,Homo sapiens,Human,Mitochondrial uncoupling protein 5,SLC25A14,Solute carrier family 25 member 14,UCP 5,UCP5,UNQ791_PRO1682
EIAAB43505 DNC,Homo sapiens,Human,Mitochondrial thiamine pyrophosphate carrier,Mitochondrial uncoupling protein 1,MUP1,SLC25A19,Solute carrier family 25 member 19
EIAAB37242 Mitochondrial S-adenosylmethionine transporter,Mouse,Mus musculus,S-adenosylmethionine mitochondrial carrier protein,Samc,Slc25a26,Solute carrier family 25 member 26
EIAAB37243 Bos taurus,Bovine,Mitochondrial S-adenosylmethionine transporter,S-adenosylmethionine mitochondrial carrier protein,SAMC,SLC25A26,Solute carrier family 25 member 26
EIAAB37244 Homo sapiens,Human,Mitochondrial S-adenosylmethionine transporter,S-adenosylmethionine mitochondrial carrier protein,SAMC,SLC25A26,Solute carrier family 25 member 26
29-926 SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a AT 0.1 mg
5158 Protein,Solute carrier family 25 (Mitochondrial carrier; ornithine transporter) member 15 0.1 mg
5158 Protein,Solute carrier family 25 (Mitochondrial carrier; ornithine transporter) member 15 0.05 mg
GWB-92F1F8 Anti- SLC25A25 (solute carrier family 25 (mitochondrial carrier; phosphate carrier). member 25) Antibody
201-20-5373 SLC25A25{solute carrier family 25 (mitochondrial carrier ; phosphate carrier), member 25}rabbit.pAb 0.2ml


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur