Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Caspase-8 (CASP-8) (EC 3.4.22.61) (Apoptotic cysteine protease) (Apoptotic protease Mch-5) (CAP4) (FADD-homologous ICE/ced-3-like protease) (FADD-like ICE) (FLICE) (ICE-like apoptotic protease 5) (MORT1-associated ced-3 homolog) (MACH) [Cleaved into: Caspase-8 subunit p18; Caspase-8 subunit p10]

 CASP8_HUMAN             Reviewed;         479 AA.
Q14790; O14676; Q14791; Q14792; Q14793; Q14794; Q14795; Q14796;
Q15780; Q15806; Q53TT5; Q8TDI1; Q8TDI2; Q8TDI3; Q8TDI4; Q8TDI5;
Q96T22; Q9C0K4; Q9UQ81;
01-NOV-1997, integrated into UniProtKB/Swiss-Prot.
01-NOV-1996, sequence version 1.
22-NOV-2017, entry version 215.
RecName: Full=Caspase-8;
Short=CASP-8;
EC=3.4.22.61;
AltName: Full=Apoptotic cysteine protease;
AltName: Full=Apoptotic protease Mch-5;
AltName: Full=CAP4;
AltName: Full=FADD-homologous ICE/ced-3-like protease;
AltName: Full=FADD-like ICE;
Short=FLICE;
AltName: Full=ICE-like apoptotic protease 5;
AltName: Full=MORT1-associated ced-3 homolog;
Short=MACH;
Contains:
RecName: Full=Caspase-8 subunit p18;
Contains:
RecName: Full=Caspase-8 subunit p10;
Flags: Precursor;
Name=CASP8; Synonyms=MCH5;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 5; 6; 7 AND 8).
TISSUE=B-cell, and Thymus;
PubMed=8681376; DOI=10.1016/S0092-8674(00)81265-9;
Boldin M.P., Goncharov T.M., Goltsev Y.V., Wallach D.;
"Involvement of MACH, a novel MORT1/FADD-interacting protease, in
Fas/APO-1- and TNF receptor-induced cell death.";
Cell 85:803-815(1996).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND PARTIAL PROTEIN SEQUENCE.
PubMed=8681377; DOI=10.1016/S0092-8674(00)81266-0;
Muzio M., Chinnaiyan A.M., Kischkel F.C., O'Rourke K., Shevchenko A.,
Ni J., Scaffidi C., Bretz J.D., Zhang M., Gentz R., Mann M.,
Krammer P.H., Peter M.E., Dixit V.M.;
"FLICE, a novel FADD-homologous ICE/CED-3-like protease, is recruited
to the CD95 (Fas/APO-1) death-inducing signaling complex.";
Cell 85:817-827(1996).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), AND VARIANT HIS-285.
TISSUE=T-cell;
PubMed=8755496; DOI=10.1073/pnas.93.15.7464;
Fernandes-Alnemri T., Armstrong R.C., Krebs J.F., Srinivasula S.M.,
Wang L., Bullrich F., Fritz L.C., Trapani J.A., Tomaselli K.J.,
Litwack G., Alnemri E.S.;
"In vitro activation of CPP32 and Mch3 by Mch4, a novel human
apoptotic cysteine protease containing two FADD-like domains.";
Proc. Natl. Acad. Sci. U.S.A. 93:7464-7469(1996).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND VARIANT HIS-285.
PubMed=9228018; DOI=10.1074/jbc.272.30.18542;
Srinivasula S.M., Ahmad M., Ottilie S., Bullrich F., Banks S.,
Wang Y., Fernandes-Alnemri T., Croce C.M., Litwack G., Tomaselli K.J.,
Armstrong R.C., Alnemri E.S.;
"FLAME-1, a novel FADD-like anti-apoptotic molecule that regulates
Fas/TNFR1-induced apoptosis.";
J. Biol. Chem. 272:18542-18545(1997).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=9931493; DOI=10.1016/S0378-1119(98)00565-4;
Grenet J., Teitz T., Wei T., Valentine V., Kidd V.J.;
"Structure and chromosome localization of the human CASP8 gene.";
Gene 226:225-232(1999).
[6]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANT HIS-285.
PubMed=11161814; DOI=10.1006/geno.2000.6392;
Hadano S., Yanagisawa Y., Skaug J., Fichter K., Nasir J.,
Martindale D., Koop B.F., Scherer S.W., Nicholson D.W., Rouleau G.A.,
Ikeda J.-E., Hayden M.R.;
"Cloning and characterization of three novel genes, ALS2CR1, ALS2CR2,
and ALS2CR3, in the juvenile amyotrophic lateral sclerosis (ALS2)
critical region at chromosome 2q33-q34: candidate genes for ALS2.";
Genomics 71:200-213(2001).
[7]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), AND FUNCTION (ISOFORM 7).
TISSUE=Leukocyte;
PubMed=12010809; DOI=10.1182/blood.V99.11.4070;
Himeji D., Horiuchi T., Tsukamoto H., Hayashi K., Watanabe T.,
Harada M.;
"Characterization of caspase-8L: a novel isoform of caspase-8 that
behaves as an inhibitor of the caspase cascade.";
Blood 99:4070-4078(2002).
[8]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 9), AND INTERACTION OF
ISOFORM 9 WITH BCAP31 AT THE ENDOPLASMIC RETICULUM.
PubMed=11917123; DOI=10.1073/pnas.072088099;
Breckenridge D.G., Nguyen M., Kuppig S., Reth M., Shore G.C.;
"The procaspase-8 isoform, procaspase-8L, recruited to the BAP31
complex at the endoplasmic reticulum.";
Proc. Natl. Acad. Sci. U.S.A. 99:4331-4336(2002).
[9]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS THR-219 AND HIS-285.
NIEHS SNPs program;
Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[11]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
TISSUE=Leukocyte;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[12]
PARTIAL PROTEIN SEQUENCE, AND PROTEOLYTIC PROCESSING.
PubMed=8962078; DOI=10.1073/pnas.93.25.14486;
Srinivasula S.M., Ahmad M., Fernandes-Alnemri T., Litwack G.,
Alnemri E.S.;
"Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1
protease Mch5 is a CrmA-inhibitable protease that activates multiple
Ced-3/ICE-like cysteine proteases.";
Proc. Natl. Acad. Sci. U.S.A. 93:14486-14491(1996).
[13]
FUNCTION.
PubMed=9006941; DOI=10.1074/jbc.272.5.2952;
Muzio M., Salvesen G.S., Dixit V.M.;
"FLICE induced apoptosis in a cell-free system. Cleavage of caspase
zymogens.";
J. Biol. Chem. 272:2952-2956(1997).
[14]
PROTEOLYTIC PROCESSING.
PubMed=9184224; DOI=10.1093/emboj/16.10.2794;
Medema J.P., Scaffidi C., Kischkel F.C., Shevchenko A., Mann M.,
Krammer P.H., Peter M.E.;
"FLICE is activated by association with the CD95 death-inducing
signaling complex (DISC).";
EMBO J. 16:2794-2804(1997).
[15]
CHARACTERIZATION (ISOFORM 7).
PubMed=10860845; DOI=10.1006/bbrc.2000.2841;
Horiuchi T., Himeji D., Tsukamoto H., Harashima S., Hashimura C.,
Hayashi K.;
"Dominant expression of a novel splice variant of caspase-8 in human
peripheral blood lymphocytes.";
Biochem. Biophys. Res. Commun. 272:877-881(2000).
[16]
INTERACTION WITH BCL2; BCL2L1 AND BCAP31.
PubMed=9334338; DOI=10.1083/jcb.139.2.327;
Ng F.W.H., Nguyen M., Kwan T., Branton P.E., Nicholson D.W.,
Cromlish J.A., Shore G.C.;
"p28 Bap31, a Bcl-2/Bcl-XL- and procaspase-8-associated protein in the
endoplasmic reticulum.";
J. Cell Biol. 139:327-338(1997).
[17]
INTERACTION WITH PEA15.
PubMed=10442631; DOI=10.1038/sj.onc.1202831;
Condorelli G., Vigliotta G., Cafieri A., Trencia A., Andalo P.,
Oriente F., Miele C., Caruso M., Formisano P., Beguinot F.;
"PED/PEA-15: an anti-apoptotic molecule that regulates FAS/TNFR1-
induced apoptosis.";
Oncogene 18:4409-4415(1999).
[18]
INTERACTION WITH HHV-5 PROTEIN UL36.
PubMed=11427719; DOI=10.1073/pnas.141108798;
Skaletskaya A., Bartle L.M., Chittenden T., McCormick A.L.,
Mocarski E.S., Goldmacher V.S.;
"A cytomegalovirus-encoded inhibitor of apoptosis that suppresses
caspase-8 activation.";
Proc. Natl. Acad. Sci. U.S.A. 98:7829-7834(2001).
[19]
SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
PubMed=14759258; DOI=10.1186/gb-2004-5-2-r8;
Hillman R.T., Green R.E., Brenner S.E.;
"An unappreciated role for RNA surveillance.";
Genome Biol. 5:R8.1-R8.16(2004).
[20]
INTERACTION WITH NOL3.
PubMed=15509781; DOI=10.1128/MCB.24.22.9763-9770.2004;
Jo D.G., Jun J.I., Chang J.W., Hong Y.M., Song S., Cho D.H.,
Shim S.M., Lee H.J., Cho C., Kim D.H., Jung Y.K.;
"Calcium binding of ARC mediates regulation of caspase 8 and cell
death.";
Mol. Cell. Biol. 24:9763-9770(2004).
[21]
INTERACTION WITH RFFL AND RNF34.
PubMed=15069192; DOI=10.1073/pnas.0307459101;
McDonald E.R. III, El-Deiry W.S.;
"Suppression of caspase-8- and -10-associated RING proteins results in
sensitization to death ligands and inhibition of tumor cell growth.";
Proc. Natl. Acad. Sci. U.S.A. 101:6170-6175(2004).
[22]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-334, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=15592455; DOI=10.1038/nbt1046;
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,
Zha X.-M., Polakiewicz R.D., Comb M.J.;
"Immunoaffinity profiling of tyrosine phosphorylation in cancer
cells.";
Nat. Biotechnol. 23:94-101(2005).
[23]
MUTAGENESIS OF ASP-73.
PubMed=15592525; DOI=10.1038/sj.onc.1208186;
Jun J.-I., Chung C.-W., Lee H.-J., Pyo J.-O., Lee K.N., Kim N.-S.,
Kim Y.S., Yoo H.-S., Lee T.-H., Kim E., Jung Y.-K.;
"Role of FLASH in caspase-8-mediated activation of NF-kappaB:
dominant-negative function of FLASH mutant in NF-kappaB signaling
pathway.";
Oncogene 24:688-696(2005).
[24]
INTERACTION WITH CASP8P2.
PubMed=17245429; DOI=10.1038/sj.emboj.7601504;
Milovic-Holm K., Krieghoff E., Jensen K., Will H., Hofmann T.G.;
"FLASH links the CD95 signaling pathway to the cell nucleus and
nuclear bodies.";
EMBO J. 26:391-401(2007).
[25]
PHOSPHORYLATION AT SER-387 BY CDK1.
PubMed=20937773; DOI=10.1128/MCB.00731-10;
Matthess Y., Raab M., Sanhaji M., Lavrik I.N., Strebhardt K.;
"Cdk1/cyclin B1 controls Fas-mediated apoptosis by regulating caspase-
8 activity.";
Mol. Cell. Biol. 30:5726-5740(2010).
[26]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[27]
INTERACTION WITH E.COLI NLEF, CATALYTIC ACTIVITY, FUNCTION, AND ENZYME
REGULATION.
PubMed=23516580; DOI=10.1371/journal.pone.0058937;
Blasche S., Mortl M., Steuber H., Siszler G., Nisa S., Schwarz F.,
Lavrik I., Gronewold T.M., Maskos K., Donnenberg M.S., Ullmann D.,
Uetz P., Kogl M.;
"The E. coli effector protein NleF is a caspase inhibitor.";
PLoS ONE 8:E58937-E58937(2013).
[28]
X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS).
PubMed=10508784; DOI=10.1016/S0969-2126(99)80179-8;
Blanchard H., Kodandapani L., Mittl P.R.E., Di Marco S., Krebs J.F.,
Wu J.C., Tomaselli K.J., Gruetter M.G.;
"The three-dimensional structure of caspase-8: an initiator enzyme in
apoptosis.";
Structure 7:1125-1133(1999).
[29]
X-RAY CRYSTALLOGRAPHY (1.2 ANGSTROMS) OF 211-479, AND SUBUNIT.
PubMed=10508785; DOI=10.1016/S0969-2126(99)80180-4;
Watt W., Koeplinger K.A., Mildner A.M., Heinrikson R.L.,
Tomasselli A.G., Watenpaugh K.D.;
"The atomic-resolution structure of human caspase-8, a key activator
of apoptosis.";
Structure 7:1135-1143(1999).
[30]
VARIANT CASP8D TRP-248.
PubMed=12353035; DOI=10.1038/nature01063;
Chun H.J., Zheng L., Ahmad M., Wang J., Speirs C.K., Siegel R.M.,
Dale J.K., Puck J., Davis J., Hall C.G., Skoda-Smith S.,
Atkinson T.P., Straus S.E., Lenardo M.J.;
"Pleiotropic defects in lymphocyte activation caused by caspase-8
mutations lead to human immunodeficiency.";
Nature 419:395-399(2002).
[31]
VARIANT HIS-285, AND PROTECTION AGAINST BREAST CANCER.
PubMed=15601643; DOI=10.1093/jnci/dji001;
MacPherson G., Healey C.S., Teare M.D., Balasubramanian S.P.,
Reed M.W.R., Pharoah P.D., Ponder B.A.J., Meuth M.,
Bhattacharyya N.P., Cox A.;
"Association of a common variant of the CASP8 gene with reduced risk
of breast cancer.";
J. Natl. Cancer Inst. 96:1866-1869(2004).
[32]
VARIANT HIS-285, AND PROTECTION AGAINST BREAST CANCER.
PubMed=17293864; DOI=10.1038/ng1981;
The Kathleen Cunningham foundation consortium for research into familial breast cancer;
Breast cancer association consortium;
Cox A., Dunning A.M., Garcia-Closas M., Balasubramanian S.,
Reed M.W.R., Pooley K.A., Scollen S., Baynes C., Ponder B.A.J.,
Chanock S., Lissowska J., Brinton L., Peplonska B., Southey M.C.,
Hopper J.L., McCredie M.R.E., Giles G.G., Fletcher O., Johnson N.,
dos Santos Silva I., Gibson L., Bojesen S.E., Nordestgaard B.G.,
Axelsson C.K., Torres D., Hamann U., Justenhoven C., Brauch H.,
Chang-Claude J., Kropp S., Risch A., Wang-Gohrke S., Schuermann P.,
Bogdanova N., Doerk T., Fagerholm R., Aaltonen K., Blomqvist C.,
Nevanlinna H., Seal S., Renwick A., Stratton M.R., Rahman N.,
Sangrajrang S., Hughes D., Odefrey F., Brennan P., Spurdle A.B.,
Chenevix-Trench G., Beesley J., Mannermaa A., Hartikainen J.,
Kataja V., Kosma V.M., Couch F.J., Olson J.E., Goode E.L., Broeks A.,
Schmidt M.K., Hogervorst F.B.L., Van't Veer L.J., Kang D., Yoo K.-Y.,
Noh D.-Y., Ahn S.-H., Wedren S., Hall P., Low Y.-L., Liu J.,
Milne R.L., Ribas G., Gonzalez-Neira A., Benitez J., Sigurdson A.J.,
Stredrick D.L., Alexander B.H., Struewing J.P., Pharoah P.D.P.,
Easton D.F.;
"A common coding variant in CASP8 is associated with breast cancer
risk.";
Nat. Genet. 39:352-358(2007).
[33]
ERRATUM.
The Kathleen Cunningham foundation consortium for research into familial breast cancer;
Breast cancer association consortium;
Cox A., Dunning A.M., Garcia-Closas M., Balasubramanian S.,
Reed M.W.R., Pooley K.A., Scollen S., Baynes C., Ponder B.A.J.,
Chanock S., Lissowska J., Brinton L., Peplonska B., Southey M.C.,
Hopper J.L., McCredie M.R.E., Giles G.G., Fletcher O., Johnson N.,
dos Santos Silva I., Gibson L., Bojesen S.E., Nordestgaard B.G.,
Axelsson C.K., Torres D., Hamann U., Justenhoven C., Brauch H.,
Chang-Claude J., Kropp S., Risch A., Wang-Gohrke S., Schuermann P.,
Bogdanova N., Doerk T., Fagerholm R., Aaltonen K., Blomqvist C.,
Nevanlinna H., Seal S., Renwick A., Stratton M.R., Rahman N.,
Sangrajrang S., Hughes D., Odefrey F., Brennan P., Spurdle A.B.,
Chenevix-Trench G., Beesley J., Mannermaa A., Hartikainen J.,
Kataja V., Kosma V.M., Couch F.J., Olson J.E., Goode E.L., Broeks A.,
Schmidt M.K., Hogervorst F.B.L., Van't Veer L.J., Kang D., Yoo K.-Y.,
Noh D.-Y., Ahn S.-H., Wedren S., Hall P., Low Y.-L., Liu J.,
Milne R.L., Ribas G., Gonzalez-Neira A., Benitez J., Sigurdson A.J.,
Stredrick D.L., Alexander B.H., Struewing J.P., Pharoah P.D.P.,
Easton D.F.;
Nat. Genet. 39:688-688(2007).
[34]
INVOLVEMENT IN PROTECTION AGAINST LUNG CANCER.
PubMed=17450141; DOI=10.1038/ng2030;
Sun T., Gao Y., Tan W., Ma S., Shi Y., Yao J., Guo Y., Yang M.,
Zhang X., Zhang Q., Zeng C., Lin D.;
"A six-nucleotide insertion-deletion polymorphism in the CASP8
promoter is associated with susceptibility to multiple cancers.";
Nat. Genet. 39:605-613(2007).
[35]
VARIANT HIS-285, AND RISK FACTOR FOR CUTANEOUS MELANOMA.
PubMed=18563783; DOI=10.1002/humu.20803;
Li C., Zhao H., Hu Z., Liu Z., Wang L.-E., Gershenwald J.E.,
Prieto V.G., Lee J.E., Duvic M., Grimm E.A., Wei Q.;
"Genetic variants and haplotypes of the caspase-8 and caspase-10 genes
contribute to susceptibility to cutaneous melanoma.";
Hum. Mutat. 29:1443-1451(2008).
-!- FUNCTION: Most upstream protease of the activation cascade of
caspases responsible for the TNFRSF6/FAS mediated and TNFRSF1A
induced cell death. Binding to the adapter molecule FADD recruits
it to either receptor. The resulting aggregate called death-
inducing signaling complex (DISC) performs CASP8 proteolytic
activation. The active dimeric enzyme is then liberated from the
DISC and free to activate downstream apoptotic proteases.
Proteolytic fragments of the N-terminal propeptide (termed CAP3,
CAP5 and CAP6) are likely retained in the DISC. Cleaves and
activates CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10. May
participate in the GZMB apoptotic pathways. Cleaves ADPRT.
Hydrolyzes the small-molecule substrate, Ac-Asp-Glu-Val-Asp-|-AMC.
Likely target for the cowpox virus CRMA death inhibitory protein.
Isoform 5, isoform 6, isoform 7 and isoform 8 lack the catalytic
site and may interfere with the pro-apoptotic activity of the
complex. {ECO:0000269|PubMed:23516580,
ECO:0000269|PubMed:9006941}.
-!- CATALYTIC ACTIVITY: Strict requirement for Asp at position P1 and
has a preferred cleavage sequence of (Leu/Asp/Val)-Glu-Thr-Asp-|-
(Gly/Ser/Ala). {ECO:0000269|PubMed:23516580}.
-!- ENZYME REGULATION: Inhibited by the effector protein NleF that is
produced by pathogenic E.coli; this inhibits apoptosis.
{ECO:0000269|PubMed:23516580}.
-!- SUBUNIT: Heterotetramer that consists of two anti-parallel
arranged heterodimers, each one formed by a 18 kDa (p18) and a 10
kDa (p10) subunit. Interacts with FADD, CFLAR and PEA15. Isoform 9
interacts at the endoplasmic reticulum with a complex containing
BCAP31, BAP29, BCL2 and/or BCL2L1. Interacts with TNFAIP8L2 (By
similarity). Interacts with CASP8AP2. Interacts with RFFL and
RNF34; negatively regulate CASP8 through proteasomal degradation.
Interacts with human cytomegalovirus/HHV-5 protein vICA/UL36; this
interaction inhibits CASP8 activation. Interacts with NleF from
pathogenic E.coli. Interacts with NOL3; decreases CASP8 activity
in a mitochondria localization- and phosphorylation-dependent
manner and this interaction is dissociated by calcium.
{ECO:0000250|UniProtKB:O89110, ECO:0000250|UniProtKB:Q9JHX4,
ECO:0000269|PubMed:10442631, ECO:0000269|PubMed:10508785,
ECO:0000269|PubMed:11427719, ECO:0000269|PubMed:11917123,
ECO:0000269|PubMed:15069192, ECO:0000269|PubMed:15509781,
ECO:0000269|PubMed:17245429, ECO:0000269|PubMed:23516580,
ECO:0000269|PubMed:9334338}.
-!- INTERACTION:
Self; NbExp=2; IntAct=EBI-78060, EBI-78060;
P10275:AR; NbExp=3; IntAct=EBI-78060, EBI-608057;
P51572:BCAP31; NbExp=3; IntAct=EBI-78060, EBI-77683;
Q92851:CASP10; NbExp=3; IntAct=EBI-78060, EBI-495095;
Q9UKL3:CASP8AP2; NbExp=3; IntAct=EBI-78060, EBI-2339650;
O15519:CFLAR; NbExp=9; IntAct=EBI-78060, EBI-514941;
O15519-1:CFLAR; NbExp=3; IntAct=EBI-15777741, EBI-4567563;
Q13618:CUL3; NbExp=6; IntAct=EBI-78060, EBI-456129;
Q13158:FADD; NbExp=42; IntAct=EBI-78060, EBI-494804;
P25445:FAS; NbExp=14; IntAct=EBI-78060, EBI-494743;
P25445-1:FAS; NbExp=3; IntAct=EBI-78060, EBI-15749113;
P48023:FASLG; NbExp=5; IntAct=EBI-78060, EBI-495538;
Q13418:ILK; NbExp=2; IntAct=EBI-78060, EBI-747644;
Q9UDY8:MALT1; NbExp=10; IntAct=EBI-78060, EBI-1047372;
O60936:NOL3; NbExp=3; IntAct=EBI-78060, EBI-740992;
P29350:PTPN6; NbExp=3; IntAct=EBI-78060, EBI-78260;
Q13546:RIPK1; NbExp=27; IntAct=EBI-78060, EBI-358507;
Q969K3:RNF34; NbExp=3; IntAct=EBI-78060, EBI-2340642;
P21580:TNFAIP3; NbExp=3; IntAct=EBI-78060, EBI-527670;
O00220:TNFRSF10A; NbExp=9; IntAct=EBI-78060, EBI-518861;
-!- SUBCELLULAR LOCATION: Cytoplasm.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=9;
Name=1; Synonyms=Alpha-1;
IsoId=Q14790-1; Sequence=Displayed;
Name=2; Synonyms=Alpha-2, MCH5-beta;
IsoId=Q14790-2; Sequence=VSP_000810;
Name=3; Synonyms=Alpha-3;
IsoId=Q14790-3; Sequence=VSP_000813;
Name=4; Synonyms=Alpha-4;
IsoId=Q14790-4; Sequence=VSP_000809, VSP_000810;
Name=5; Synonyms=Beta-1;
IsoId=Q14790-5; Sequence=VSP_000814, VSP_000815;
Name=6; Synonyms=Beta-2;
IsoId=Q14790-6; Sequence=VSP_000811, VSP_000812;
Name=7; Synonyms=Beta-3, 8L;
IsoId=Q14790-7; Sequence=VSP_000816, VSP_000817;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=8; Synonyms=Beta-4;
IsoId=Q14790-8; Sequence=VSP_000810, VSP_000816, VSP_000817;
Name=9; Synonyms=8L;
IsoId=Q14790-9; Sequence=VSP_000808;
Note=Ref.8 (AAL87628) sequence is in conflict in position:
14:K->R. {ECO:0000305};
-!- TISSUE SPECIFICITY: Isoform 1, isoform 5 and isoform 7 are
expressed in a wide variety of tissues. Highest expression in
peripheral blood leukocytes, spleen, thymus and liver. Barely
detectable in brain, testis and skeletal muscle.
-!- DOMAIN: Isoform 9 contains a N-terminal extension that is required
for interaction with the BCAP31 complex.
-!- PTM: Generation of the subunits requires association with the
death-inducing signaling complex (DISC), whereas additional
processing is likely due to the autocatalytic activity of the
activated protease. GZMB and CASP10 can be involved in these
processing events. {ECO:0000269|PubMed:8962078,
ECO:0000269|PubMed:9184224}.
-!- PTM: Phosphorylation on Ser-387 during mitosis by CDK1 inhibits
activation by proteolysis and prevents apoptosis. This
phosphorylation occurs in cancer cell lines, as well as in primary
breast tissues and lymphocytes. {ECO:0000269|PubMed:20937773}.
-!- POLYMORPHISM: Genetic variations in CASP8 are associated with
reduced risk of lung cancer [MIM:211980] in a population of Han
Chinese subjects. Genetic variations are also associated with
decreased risk of cancer of various other forms including
esophageal, gastric, colorectal, cervical, and breast, acting in
an allele dose-dependent manner. {ECO:0000269|PubMed:17450141}.
-!- DISEASE: Caspase-8 deficiency (CASP8D) [MIM:607271]: Disorder
resembling autoimmune lymphoproliferative syndrome (ALPS). It is
characterized by lymphadenopathy, splenomegaly, and defective
CD95-induced apoptosis of peripheral blood lymphocytes (PBLs). It
leads to defects in activation of T-lymphocytes, B-lymphocytes,
and natural killer cells leading to immunodeficiency characterized
by recurrent sinopulmonary and herpes simplex virus infections and
poor responses to immunization. {ECO:0000269|PubMed:12353035}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-!- SIMILARITY: Belongs to the peptidase C14A family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=CAA66858.1; Type=Miscellaneous discrepancy; Evidence={ECO:0000305};
Sequence=CAA66859.1; Type=Miscellaneous discrepancy; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=CASP8base; Note=CASP8 mutation db;
URL="http://structure.bmc.lu.se/idbase/CASP8base/";
-!- WEB RESOURCE: Name=NIEHS-SNPs;
URL="http://egp.gs.washington.edu/data/casp8/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X98172; CAA66853.1; -; mRNA.
EMBL; X98173; CAA66854.1; -; mRNA.
EMBL; X98174; CAA66855.1; -; mRNA.
EMBL; X98175; CAA66856.1; -; mRNA.
EMBL; X98176; CAA66857.1; -; mRNA.
EMBL; X98177; CAA66858.1; ALT_SEQ; mRNA.
EMBL; X98178; CAA66859.1; ALT_SEQ; mRNA.
EMBL; U58143; AAC50602.1; -; mRNA.
EMBL; U60520; AAC50645.1; -; mRNA.
EMBL; AF009620; AAB70913.1; -; mRNA.
EMBL; AF102146; AAD24962.1; -; Genomic_DNA.
EMBL; AF102139; AAD24962.1; JOINED; Genomic_DNA.
EMBL; AF102140; AAD24962.1; JOINED; Genomic_DNA.
EMBL; AF102141; AAD24962.1; JOINED; Genomic_DNA.
EMBL; AF102142; AAD24962.1; JOINED; Genomic_DNA.
EMBL; AF102143; AAD24962.1; JOINED; Genomic_DNA.
EMBL; AF102144; AAD24962.1; JOINED; Genomic_DNA.
EMBL; AF102145; AAD24962.1; JOINED; Genomic_DNA.
EMBL; AB038985; BAB32555.1; -; Genomic_DNA.
EMBL; AF380342; AAK57437.1; -; mRNA.
EMBL; AF422925; AAL87628.1; -; mRNA.
EMBL; AF422926; AAL87629.1; -; mRNA.
EMBL; AF422927; AAL87630.1; -; mRNA.
EMBL; AF422928; AAL87631.1; -; mRNA.
EMBL; AF422929; AAL87632.1; -; mRNA.
EMBL; DQ355026; ABC67468.1; -; Genomic_DNA.
EMBL; AC007256; AAY24225.1; -; Genomic_DNA.
EMBL; BC028223; -; NOT_ANNOTATED_CDS; mRNA.
CCDS; CCDS2342.1; -. [Q14790-1]
CCDS; CCDS2343.1; -. [Q14790-2]
CCDS; CCDS2345.1; -. [Q14790-5]
CCDS; CCDS42798.1; -. [Q14790-9]
CCDS; CCDS42799.1; -. [Q14790-4]
RefSeq; NP_001073593.1; NM_001080124.1. [Q14790-2]
RefSeq; NP_001073594.1; NM_001080125.1. [Q14790-9]
RefSeq; NP_001219.2; NM_001228.4. [Q14790-4]
RefSeq; NP_203519.1; NM_033355.3. [Q14790-1]
RefSeq; NP_203520.1; NM_033356.3. [Q14790-2]
RefSeq; NP_203522.1; NM_033358.3. [Q14790-5]
RefSeq; XP_005246943.1; XM_005246886.1. [Q14790-1]
RefSeq; XP_005246944.1; XM_005246887.1. [Q14790-1]
RefSeq; XP_005246945.1; XM_005246888.1. [Q14790-1]
RefSeq; XP_005246946.1; XM_005246889.1. [Q14790-1]
RefSeq; XP_005246947.1; XM_005246890.3. [Q14790-1]
RefSeq; XP_005246948.1; XM_005246891.4. [Q14790-1]
RefSeq; XP_005246949.1; XM_005246892.1. [Q14790-2]
RefSeq; XP_006712852.1; XM_006712789.1. [Q14790-1]
RefSeq; XP_006712853.1; XM_006712790.3. [Q14790-1]
RefSeq; XP_006712856.1; XM_006712793.2. [Q14790-5]
UniGene; Hs.599762; -.
PDB; 1F9E; X-ray; 2.90 A; A/C/E/G/I/K=222-374, B/D/F/H/J/L=390-478.
PDB; 1I4E; X-ray; 3.00 A; B=222-479.
PDB; 1QDU; X-ray; 2.80 A; A/C/E/G/I/K=222-374, B/D/F/H/J/L=390-477.
PDB; 1QTN; X-ray; 1.20 A; A=211-374, B=385-479.
PDB; 2C2Z; X-ray; 1.95 A; A=218-374, B=376-479.
PDB; 2FUN; X-ray; 3.00 A; B/D=222-479.
PDB; 2K7Z; NMR; -; A=217-479.
PDB; 2Y1L; X-ray; 1.80 A; A/C=218-374, B/D=376-479.
PDB; 3H11; X-ray; 1.90 A; B=217-479.
PDB; 3KJN; X-ray; 1.80 A; A=211-374, B=385-479.
PDB; 3KJQ; X-ray; 1.80 A; A=211-374, B=385-479.
PDB; 4JJ7; X-ray; 1.18 A; A=217-479.
PDB; 4PRZ; X-ray; 2.12 A; A=217-479.
PDB; 4PS1; X-ray; 1.73 A; A/B/C/D=217-479.
PDB; 4ZBW; X-ray; 2.20 A; A/B=2-188.
PDB; 5JQE; X-ray; 3.16 A; A=1-186.
PDB; 5L08; EM; 4.60 A; A/B/C/D/E/F/G/H/I=1-184.
PDBsum; 1F9E; -.
PDBsum; 1I4E; -.
PDBsum; 1QDU; -.
PDBsum; 1QTN; -.
PDBsum; 2C2Z; -.
PDBsum; 2FUN; -.
PDBsum; 2K7Z; -.
PDBsum; 2Y1L; -.
PDBsum; 3H11; -.
PDBsum; 3KJN; -.
PDBsum; 3KJQ; -.
PDBsum; 4JJ7; -.
PDBsum; 4PRZ; -.
PDBsum; 4PS1; -.
PDBsum; 4ZBW; -.
PDBsum; 5JQE; -.
PDBsum; 5L08; -.
ProteinModelPortal; Q14790; -.
SMR; Q14790; -.
BioGrid; 107291; 148.
CORUM; Q14790; -.
DIP; DIP-30915N; -.
ELM; Q14790; -.
IntAct; Q14790; 121.
MINT; MINT-91645; -.
STRING; 9606.ENSP00000351273; -.
BindingDB; Q14790; -.
ChEMBL; CHEMBL3776; -.
GuidetoPHARMACOLOGY; 1624; -.
MEROPS; C14.009; -.
iPTMnet; Q14790; -.
PhosphoSitePlus; Q14790; -.
SwissPalm; Q14790; -.
BioMuta; CASP8; -.
DMDM; 2493531; -.
EPD; Q14790; -.
MaxQB; Q14790; -.
PaxDb; Q14790; -.
PeptideAtlas; Q14790; -.
PRIDE; Q14790; -.
DNASU; 841; -.
Ensembl; ENST00000264274; ENSP00000264274; ENSG00000064012. [Q14790-3]
Ensembl; ENST00000264275; ENSP00000264275; ENSG00000064012. [Q14790-4]
Ensembl; ENST00000323492; ENSP00000325722; ENSG00000064012. [Q14790-2]
Ensembl; ENST00000358485; ENSP00000351273; ENSG00000064012. [Q14790-9]
Ensembl; ENST00000392258; ENSP00000376087; ENSG00000064012. [Q14790-5]
Ensembl; ENST00000392263; ENSP00000376091; ENSG00000064012. [Q14790-2]
Ensembl; ENST00000432109; ENSP00000412523; ENSG00000064012. [Q14790-1]
GeneID; 841; -.
KEGG; hsa:841; -.
UCSC; uc002uxo.2; human. [Q14790-1]
CTD; 841; -.
DisGeNET; 841; -.
EuPathDB; HostDB:ENSG00000064012.21; -.
GeneCards; CASP8; -.
HGNC; HGNC:1509; CASP8.
HPA; CAB002047; -.
HPA; HPA001302; -.
HPA; HPA005688; -.
HPA; HPA006191; -.
MalaCards; CASP8; -.
MIM; 211980; phenotype.
MIM; 601763; gene.
MIM; 607271; phenotype.
neXtProt; NX_Q14790; -.
OpenTargets; ENSG00000064012; -.
Orphanet; 275517; Autoimmune lymphoproliferative syndrome with recurrent viral infections.
PharmGKB; PA26092; -.
eggNOG; KOG3573; Eukaryota.
eggNOG; ENOG410ZQIE; LUCA.
GeneTree; ENSGT00760000118912; -.
HOVERGEN; HBG050803; -.
InParanoid; Q14790; -.
KO; K04398; -.
OMA; IFIEMEK; -.
OrthoDB; EOG091G05YD; -.
PhylomeDB; Q14790; -.
TreeFam; TF102023; -.
BRENDA; 3.4.22.61; 2681.
Reactome; R-HSA-111465; Apoptotic cleavage of cellular proteins.
Reactome; R-HSA-140534; Ligand-dependent caspase activation.
Reactome; R-HSA-168638; NOD1/2 Signaling Pathway.
Reactome; R-HSA-2562578; TRIF-mediated programmed cell death.
Reactome; R-HSA-264870; Caspase-mediated cleavage of cytoskeletal proteins.
Reactome; R-HSA-3371378; Regulation by c-FLIP.
Reactome; R-HSA-5213460; RIPK1-mediated regulated necrosis.
Reactome; R-HSA-5218900; CASP8 activity is inhibited.
Reactome; R-HSA-5357786; TNFR1-induced proapoptotic signaling.
Reactome; R-HSA-5357905; Regulation of TNFR1 signaling.
Reactome; R-HSA-5660668; CLEC7A/inflammasome pathway.
Reactome; R-HSA-5675482; Regulation of necroptotic cell death.
Reactome; R-HSA-69416; Dimerization of procaspase-8.
Reactome; R-HSA-75108; Activation, myristolyation of BID and translocation to mitochondria.
Reactome; R-HSA-75153; Apoptotic execution phase.
Reactome; R-HSA-75157; FasL/ CD95L signaling.
Reactome; R-HSA-75158; TRAIL signaling.
Reactome; R-HSA-9013957; TLR3-mediated TICAM1-dependent programmed cell death.
Reactome; R-HSA-933543; NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10.
SignaLink; Q14790; -.
SIGNOR; Q14790; -.
ChiTaRS; CASP8; human.
EvolutionaryTrace; Q14790; -.
GeneWiki; Caspase_8; -.
GenomeRNAi; 841; -.
PMAP-CutDB; Q14790; -.
PRO; PR:Q14790; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000064012; -.
ExpressionAtlas; Q14790; baseline and differential.
Genevisible; Q14790; HS.
GO; GO:0031265; C:CD95 death-inducing signaling complex; IDA:UniProtKB.
GO; GO:0044297; C:cell body; IEA:Ensembl.
GO; GO:0005856; C:cytoskeleton; TAS:ProtInc.
GO; GO:0005829; C:cytosol; IDA:UniProtKB.
GO; GO:0031264; C:death-inducing signaling complex; IDA:UniProtKB.
GO; GO:0045121; C:membrane raft; IEA:Ensembl.
GO; GO:0005741; C:mitochondrial outer membrane; TAS:Reactome.
GO; GO:0005739; C:mitochondrion; TAS:ProtInc.
GO; GO:0043005; C:neuron projection; IEA:Ensembl.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0097342; C:ripoptosome; IDA:UniProtKB.
GO; GO:0004197; F:cysteine-type endopeptidase activity; IDA:UniProtKB.
GO; GO:0097153; F:cysteine-type endopeptidase activity involved in apoptotic process; IMP:UniProtKB.
GO; GO:0097199; F:cysteine-type endopeptidase activity involved in apoptotic signaling pathway; IMP:UniProtKB.
GO; GO:0097200; F:cysteine-type endopeptidase activity involved in execution phase of apoptosis; IBA:GO_Central.
GO; GO:0008234; F:cysteine-type peptidase activity; TAS:ProtInc.
GO; GO:0035877; F:death effector domain binding; IPI:UniProtKB.
GO; GO:0005123; F:death receptor binding; IEA:Ensembl.
GO; GO:0042802; F:identical protein binding; IPI:IntAct.
GO; GO:0008233; F:peptidase activity; IDA:BHF-UCL.
GO; GO:0032403; F:protein complex binding; IEA:Ensembl.
GO; GO:0097110; F:scaffold protein binding; IPI:ParkinsonsUK-UCL.
GO; GO:0005164; F:tumor necrosis factor receptor binding; IEA:Ensembl.
GO; GO:0031625; F:ubiquitin protein ligase binding; IPI:UniProtKB.
GO; GO:0097202; P:activation of cysteine-type endopeptidase activity; IDA:BHF-UCL.
GO; GO:0006919; P:activation of cysteine-type endopeptidase activity involved in apoptotic process; TAS:Reactome.
GO; GO:0097296; P:activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway; TAS:Reactome.
GO; GO:0006915; P:apoptotic process; IMP:UniProtKB.
GO; GO:0097190; P:apoptotic signaling pathway; IMP:BHF-UCL.
GO; GO:0042113; P:B cell activation; TAS:UniProtKB.
GO; GO:0007166; P:cell surface receptor signaling pathway; TAS:Reactome.
GO; GO:0071260; P:cellular response to mechanical stimulus; IEP:UniProtKB.
GO; GO:0071407; P:cellular response to organic cyclic compound; IEA:Ensembl.
GO; GO:0071550; P:death-inducing signaling complex assembly; TAS:Reactome.
GO; GO:0097194; P:execution phase of apoptosis; IMP:UniProtKB.
GO; GO:0097191; P:extrinsic apoptotic signaling pathway; IDA:UniProtKB.
GO; GO:0030225; P:macrophage differentiation; TAS:UniProtKB.
GO; GO:0030101; P:natural killer cell activation; TAS:UniProtKB.
GO; GO:1902042; P:negative regulation of extrinsic apoptotic signaling pathway via death domain receptors; TAS:Reactome.
GO; GO:0043124; P:negative regulation of I-kappaB kinase/NF-kappaB signaling; IMP:UniProtKB.
GO; GO:0070423; P:nucleotide-binding oligomerization domain containing signaling pathway; TAS:Reactome.
GO; GO:0043123; P:positive regulation of I-kappaB kinase/NF-kappaB signaling; IMP:UniProtKB.
GO; GO:0045651; P:positive regulation of macrophage differentiation; IMP:UniProtKB.
GO; GO:1901216; P:positive regulation of neuron death; IEA:Ensembl.
GO; GO:1900740; P:positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway; TAS:Reactome.
GO; GO:0045862; P:positive regulation of proteolysis; IDA:BHF-UCL.
GO; GO:0006508; P:proteolysis; IDA:UniProtKB.
GO; GO:0051603; P:proteolysis involved in cellular protein catabolic process; IMP:BHF-UCL.
GO; GO:1902041; P:regulation of extrinsic apoptotic signaling pathway via death domain receptors; TAS:Reactome.
GO; GO:0060544; P:regulation of necroptotic process; TAS:Reactome.
GO; GO:0010803; P:regulation of tumor necrosis factor-mediated signaling pathway; TAS:Reactome.
GO; GO:0046677; P:response to antibiotic; IEA:Ensembl.
GO; GO:0032025; P:response to cobalt ion; IEA:Ensembl.
GO; GO:0009409; P:response to cold; IEA:Ensembl.
GO; GO:0032355; P:response to estradiol; IEA:Ensembl.
GO; GO:0045471; P:response to ethanol; IEA:Ensembl.
GO; GO:0032496; P:response to lipopolysaccharide; IEA:Ensembl.
GO; GO:0034612; P:response to tumor necrosis factor; IMP:BHF-UCL.
GO; GO:0039650; P:suppression by virus of host cysteine-type endopeptidase activity involved in apoptotic process; TAS:Reactome.
GO; GO:0060715; P:syncytiotrophoblast cell differentiation involved in labyrinthine layer development; TAS:UniProtKB.
GO; GO:0042110; P:T cell activation; TAS:UniProtKB.
GO; GO:0036462; P:TRAIL-activated apoptotic signaling pathway; IDA:ParkinsonsUK-UCL.
GO; GO:0035666; P:TRIF-dependent toll-like receptor signaling pathway; TAS:Reactome.
CDD; cd00032; CASc; 1.
InterPro; IPR033170; Caspase-8.
InterPro; IPR029030; Caspase-like_dom_sf.
InterPro; IPR033139; Caspase_cys_AS.
InterPro; IPR016129; Caspase_his_AS.
InterPro; IPR011029; DEATH-like_dom_sf.
InterPro; IPR001875; DED_dom.
InterPro; IPR002138; Pept_C14_p10.
InterPro; IPR001309; Pept_C14_p20.
InterPro; IPR015917; Pept_C14A.
PANTHER; PTHR10454:SF162; PTHR10454:SF162; 1.
Pfam; PF01335; DED; 2.
PRINTS; PR00376; IL1BCENZYME.
SMART; SM00115; CASc; 1.
SMART; SM00031; DED; 2.
SUPFAM; SSF47986; SSF47986; 2.
SUPFAM; SSF52129; SSF52129; 1.
PROSITE; PS01122; CASPASE_CYS; 1.
PROSITE; PS01121; CASPASE_HIS; 1.
PROSITE; PS50207; CASPASE_P10; 1.
PROSITE; PS50208; CASPASE_P20; 1.
PROSITE; PS50168; DED; 2.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Apoptosis;
Complete proteome; Cytoplasm; Direct protein sequencing;
Disease mutation; Host-virus interaction; Hydrolase; Phosphoprotein;
Polymorphism; Protease; Reference proteome; Repeat; Thiol protease;
Zymogen.
PROPEP 1 216
/FTId=PRO_0000004628.
CHAIN 217 374 Caspase-8 subunit p18.
/FTId=PRO_0000004629.
PROPEP 375 384
/FTId=PRO_0000004630.
CHAIN 385 479 Caspase-8 subunit p10.
/FTId=PRO_0000004631.
DOMAIN 2 80 DED 1. {ECO:0000255|PROSITE-
ProRule:PRU00065}.
DOMAIN 100 177 DED 2. {ECO:0000255|PROSITE-
ProRule:PRU00065}.
ACT_SITE 317 317
ACT_SITE 360 360
MOD_RES 188 188 Phosphoserine.
{ECO:0000250|UniProtKB:O89110}.
MOD_RES 211 211 Phosphoserine.
{ECO:0000250|UniProtKB:O89110}.
MOD_RES 224 224 N6-acetyllysine.
{ECO:0000250|UniProtKB:O89110}.
MOD_RES 334 334 Phosphotyrosine.
{ECO:0000244|PubMed:15592455}.
MOD_RES 387 387 Phosphoserine; by CDK1.
{ECO:0000269|PubMed:20937773}.
VAR_SEQ 1 1 M -> MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRL
GDSETAMVPGKGGADYILLPFKKM (in isoform 9).
{ECO:0000303|PubMed:11917123}.
/FTId=VSP_000808.
VAR_SEQ 102 102 R -> RFHFCRMSWAEANSQCQTQSVPFWRRVDHLLIR
(in isoform 4).
{ECO:0000303|PubMed:8755496}.
/FTId=VSP_000809.
VAR_SEQ 184 267 Missing (in isoform 3).
{ECO:0000303|PubMed:8681376}.
/FTId=VSP_000813.
VAR_SEQ 184 220 ERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQ ->
DFGQSLPNEKQTSGILSDHQQSQFCKSTGESAQTSQH (in
isoform 6). {ECO:0000303|PubMed:8681376}.
/FTId=VSP_000811.
VAR_SEQ 184 198 Missing (in isoform 2, isoform 4 and
isoform 8). {ECO:0000303|PubMed:11917123,
ECO:0000303|PubMed:8681376,
ECO:0000303|PubMed:8755496,
ECO:0000303|PubMed:9228018}.
/FTId=VSP_000810.
VAR_SEQ 199 235 GEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGY ->
DFGQSLPNEKQTSGILSDHQQSQFCKSTGESAQTSQH (in
isoform 5). {ECO:0000303|PubMed:8681376}.
/FTId=VSP_000814.
VAR_SEQ 221 479 Missing (in isoform 6).
{ECO:0000303|PubMed:8681376}.
/FTId=VSP_000812.
VAR_SEQ 236 479 Missing (in isoform 5).
{ECO:0000303|PubMed:8681376}.
/FTId=VSP_000815.
VAR_SEQ 269 276 ALTTTFEE -> TVEPKREK (in isoform 7 and
isoform 8). {ECO:0000303|PubMed:12010809,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:8681376}.
/FTId=VSP_000816.
VAR_SEQ 277 479 Missing (in isoform 7 and isoform 8).
{ECO:0000303|PubMed:12010809,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:8681376}.
/FTId=VSP_000817.
VARIANT 219 219 S -> T (in dbSNP:rs35976359).
{ECO:0000269|Ref.9}.
/FTId=VAR_025816.
VARIANT 248 248 R -> W (in CASP8D; dbSNP:rs17860424).
{ECO:0000269|PubMed:12353035}.
/FTId=VAR_014204.
VARIANT 285 285 D -> H (associated with protection
against breast cancer; also associated
with a lower risk of cutaneous melanoma;
dbSNP:rs1045485).
{ECO:0000269|PubMed:11161814,
ECO:0000269|PubMed:15601643,
ECO:0000269|PubMed:17293864,
ECO:0000269|PubMed:18563783,
ECO:0000269|PubMed:8755496,
ECO:0000269|PubMed:9228018,
ECO:0000269|Ref.9}.
/FTId=VAR_020127.
MUTAGEN 73 73 D->A: Abolishes binding to FLASH. Induces
NF-kappa-B activation.
{ECO:0000269|PubMed:15592525}.
MUTAGEN 387 387 S->A: Impaired CDK1-mediated
phosphorylation and enhanced apoptosis.
CONFLICT 294 294 E -> D (in Ref. 5; AAD24962).
{ECO:0000305}.
CONFLICT 331 331 A -> P (in Ref. 2; AAC50602 and 5;
AAD24962). {ECO:0000305}.
CONFLICT 343 344 LK -> FG (in Ref. 8; AAL87631).
{ECO:0000305}.
HELIX 3 13 {ECO:0000244|PDB:4ZBW}.
HELIX 16 25 {ECO:0000244|PDB:4ZBW}.
TURN 26 29 {ECO:0000244|PDB:4ZBW}.
HELIX 32 34 {ECO:0000244|PDB:4ZBW}.
HELIX 41 50 {ECO:0000244|PDB:4ZBW}.
STRAND 53 55 {ECO:0000244|PDB:4ZBW}.
HELIX 60 68 {ECO:0000244|PDB:4ZBW}.
HELIX 72 79 {ECO:0000244|PDB:4ZBW}.
HELIX 83 91 {ECO:0000244|PDB:4ZBW}.
TURN 93 95 {ECO:0000244|PDB:4ZBW}.
HELIX 100 111 {ECO:0000244|PDB:4ZBW}.
HELIX 114 127 {ECO:0000244|PDB:4ZBW}.
HELIX 139 148 {ECO:0000244|PDB:4ZBW}.
STRAND 151 153 {ECO:0000244|PDB:5JQE}.
HELIX 158 165 {ECO:0000244|PDB:4ZBW}.
HELIX 169 180 {ECO:0000244|PDB:4ZBW}.
STRAND 230 232 {ECO:0000244|PDB:3H11}.
STRAND 235 240 {ECO:0000244|PDB:4JJ7}.
HELIX 245 250 {ECO:0000244|PDB:4JJ7}.
HELIX 252 254 {ECO:0000244|PDB:4JJ7}.
STRAND 255 257 {ECO:0000244|PDB:2K7Z}.
HELIX 263 276 {ECO:0000244|PDB:4JJ7}.
STRAND 280 286 {ECO:0000244|PDB:4JJ7}.
HELIX 289 301 {ECO:0000244|PDB:4JJ7}.
HELIX 304 306 {ECO:0000244|PDB:1QDU}.
STRAND 310 316 {ECO:0000244|PDB:4JJ7}.
STRAND 322 324 {ECO:0000244|PDB:4JJ7}.
STRAND 326 328 {ECO:0000244|PDB:1I4E}.
STRAND 330 332 {ECO:0000244|PDB:4JJ7}.
HELIX 333 337 {ECO:0000244|PDB:4JJ7}.
HELIX 338 340 {ECO:0000244|PDB:4JJ7}.
TURN 342 344 {ECO:0000244|PDB:4JJ7}.
HELIX 346 348 {ECO:0000244|PDB:4JJ7}.
STRAND 353 359 {ECO:0000244|PDB:4JJ7}.
STRAND 361 364 {ECO:0000244|PDB:4JJ7}.
STRAND 369 371 {ECO:0000244|PDB:1QDU}.
STRAND 377 379 {ECO:0000244|PDB:2K7Z}.
STRAND 392 394 {ECO:0000244|PDB:1QDU}.
TURN 395 398 {ECO:0000244|PDB:4JJ7}.
STRAND 399 405 {ECO:0000244|PDB:4JJ7}.
STRAND 412 414 {ECO:0000244|PDB:3H11}.
TURN 415 417 {ECO:0000244|PDB:4JJ7}.
HELIX 420 432 {ECO:0000244|PDB:4JJ7}.
HELIX 433 435 {ECO:0000244|PDB:4JJ7}.
HELIX 439 450 {ECO:0000244|PDB:4JJ7}.
TURN 456 459 {ECO:0000244|PDB:4JJ7}.
STRAND 465 468 {ECO:0000244|PDB:4JJ7}.
STRAND 471 473 {ECO:0000244|PDB:1QDU}.
SEQUENCE 479 AA; 55391 MW; 7A5FEAA6B39B582F CRC64;
MDFSRNLYDI GEQLDSEDLA SLKFLSLDYI PQRKQEPIKD ALMLFQRLQE KRMLEESNLS
FLKELLFRIN RLDLLITYLN TRKEEMEREL QTPGRAQISA YRVMLYQISE EVSRSELRSF
KFLLQEEISK CKLDDDMNLL DIFIEMEKRV ILGEGKLDIL KRVCAQINKS LLKIINDYEE
FSKERSSSLE GSPDEFSNGE ELCGVMTISD SPREQDSESQ TLDKVYQMKS KPRGYCLIIN
NHNFAKAREK VPKLHSIRDR NGTHLDAGAL TTTFEELHFE IKPHDDCTVE QIYEILKIYQ
LMDHSNMDCF ICCILSHGDK GIIYGTDGQE APIYELTSQF TGLKCPSLAG KPKVFFIQAC
QGDNYQKGIP VETDSEEQPY LEMDLSSPQT RYIPDEADFL LGMATVNNCV SYRNPAEGTW
YIQSLCQSLR ERCPRGDDIL TILTEVNYEV SNKDDKKNMG KQMPQPTFTL RKKLVFPSD


Related products :

Catalog number Product name Quantity
E2015h ELISA Apoptotic cysteine protease,Apoptotic protease Mch-5,CAP4,CASP8,CASP-8,Caspase-8,FADD-homologous ICE_ced-3-like protease,FADD-like ICE,FLICE,Homo sapiens,Human,ICE-like apoptotic protease 5,MACH 96T
U2015h CLIA Apoptotic cysteine protease,Apoptotic protease Mch-5,CAP4,CASP8,CASP-8,Caspase-8,FADD-homologous ICE_ced-3-like protease,FADD-like ICE,FLICE,Homo sapiens,Human,ICE-like apoptotic protease 5,MACH, 96T
15-288-21154 Caspase-8 - EC 3.4.22.-; CASP-8; ICE-like apoptotic protease 5; MORT1-associated CED-3 homolog; MACH; FADD-homologous ICE_CED-3-like protease; FADD-like ICE; FLICE; Apoptotic cysteine protease; Apopto 0.05 mg
18-661-15227 Caspase-8 - EC 3.4.22.-; CASP-8; ICE-like apoptotic protease 5; MORT1-associated CED-3 homolog; MACH; FADD-homologous ICE_CED-3-like protease; FADD-like ICE; FLICE; Apoptotic cysteine protease; Apopto 0.1 mg
18-661-15226 Caspase-8 - EC 3.4.22.-; CASP-8; ICE-like apoptotic protease 5; MORT1-associated CED-3 homolog; MACH; FADD-homologous ICE_CED-3-like protease; FADD-like ICE; FLICE; Apoptotic cysteine protease; Apopto 0.1 mg
15-288-21154 Caspase-8 - EC 3.4.22.-; CASP-8; ICE-like apoptotic protease 5; MORT1-associated CED-3 homolog; MACH; FADD-homologous ICE_CED-3-like protease; FADD-like ICE; FLICE; Apoptotic cysteine protease; Apopto 0.1 mg
E2015h ELISA kit Apoptotic cysteine protease,Apoptotic protease Mch-5,CAP4,CASP8,CASP-8,Caspase-8,FADD-homologous ICE_ced-3-like protease,FADD-like ICE,FLICE,Homo sapiens,Human,ICE-like apoptotic protease 5 96T
U2015h CLIA kit Apoptotic cysteine protease,Apoptotic protease Mch-5,CAP4,CASP8,CASP-8,Caspase-8,FADD-homologous ICE_ced-3-like protease,FADD-like ICE,FLICE,Homo sapiens,Human,ICE-like apoptotic protease 5, 96T
18-272-195090 Caspase 8 - Rabbit polyclonal to Caspase 8; EC 3.4.22.61; CASP-8; ICE-like apoptotic protease 5; MORT1-associated CED-3 homolog; MACH; FADD-homologous ICE_CED-3-like protease; FADD-like ICE; FLICE; Ap 0.1 ml
18-272-195091 Caspase 8 - Rabbit polyclonal to Caspase 8; EC 3.4.22.61; CASP-8; ICE-like apoptotic protease 5; MORT1-associated CED-3 homolog; MACH; FADD-homologous ICE_CED-3-like protease; FADD-like ICE; FLICE; Ap 0.1 ml
20-272-192408 Caspase 8 - Mouse monoclonal [C502S] to Caspase 8; EC 3.4.22.61; CASP-8; ICE-like apoptotic protease 5; MORT1-associated CED-3 homolog; MACH; FADD-homologous ICE_CED-3-like protease; FADD-like ICE; FL 0.05 mg
18-272-196464 Caspase 8 prediluted - Rabbit polyclonal to Caspase 8 prediluted; EC 3.4.22.61; CASP-8; ICE-like apoptotic protease 5; MORT1-associated CED-3 homolog; MACH; FADD-homologous ICE_CED-3-like protease; FA 7 ml
U0627h CLIA APAF-3,Apoptotic protease Mch-6,Apoptotic protease-activating factor 3,CASP9,CASP-9,Caspase-9,Homo sapiens,Human,ICE-LAP6,ICE-like apoptotic protease 6,MCH6 96T
E0627h ELISA APAF-3,Apoptotic protease Mch-6,Apoptotic protease-activating factor 3,CASP9,CASP-9,Caspase-9,Homo sapiens,Human,ICE-LAP6,ICE-like apoptotic protease 6,MCH6 96T
E0627h ELISA kit APAF-3,Apoptotic protease Mch-6,Apoptotic protease-activating factor 3,CASP9,CASP-9,Caspase-9,Homo sapiens,Human,ICE-LAP6,ICE-like apoptotic protease 6,MCH6 96T
18-272-197070 active Caspase 9 - Rabbit polyclonal to active Caspase 9; EC 3.4.22.62; CASP-9; ICE-like apoptotic protease 6; ICE-LAP6; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF-3 Polycl 0.05 mg
18-272-197069 active Caspase 9 - Rabbit polyclonal to active Caspase 9; EC 3.4.22.62; CASP-9; ICE-like apoptotic protease 6; ICE-LAP6; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF-3 Polycl 0.05 mg
18-272-196465 Caspase 9 prediluted - Rabbit polyclonal to Caspase 9 prediluted; EC 3.4.22.62; CASP-9; ICE-like apoptotic protease 6; ICE-LAP6; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF- 7 ml
18-661-15045 Caspase-9 - EC 3.4.22.-; CASP-9; ICE-like apoptotic protease 6; ICE-LAP6; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF-3 Polyclonal 0.1 mg
18-661-15044 Caspase-9 - EC 3.4.22.-; CASP-9; ICE-like apoptotic protease 6; ICE-LAP6; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF-3 Polyclonal 0.1 mg
18-272-197018 Caspase 9 - Rabbit polyclonal to Caspase 9; EC 3.4.22.62; CASP-9; ICE-like apoptotic protease 6; ICE-LAP6; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF-3 Polyclonal 0.1 mg
20-272-191348 Caspase 9 - Mouse monoclonal [1-2] to Caspase 9; EC 3.4.22.62; CASP-9; ICE-like apoptotic protease 6; ICE-LAP6; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF-3 Monoclonal 0.05 mg
18-272-197017 Caspase 9 - Rabbit polyclonal to Caspase 9; EC 3.4.22.62; CASP-9; ICE-like apoptotic protease 6; ICE-LAP6; Apoptotic protease Mch-6; Apoptotic protease-activating factor 3; APAF-3 Polyclonal 0.1 mg
20-272-190222 Caspase 10 - Rat monoclonal [25C2] to Caspase 10; EC 3.4.22.63; CASP-10; ICE-like apoptotic protease 4; Apoptotic protease Mch-4; FAS-associated death domain protein interleukin-1B-converting enzyme 2 0.1 ml
18-272-195092 Caspase 10 - Rabbit polyclonal to Caspase 10; EC 3.4.22.63; CASP-10; ICE-like apoptotic protease 4; Apoptotic protease Mch-4; FAS-associated death domain protein interleukin-1B-converting enzyme 2; FL 0.1 ml


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur