Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Cationic amino acid transporter 2 (CAT-2) (CAT2) (Low affinity cationic amino acid transporter 2) (Solute carrier family 7 member 2)

 CTR2_HUMAN              Reviewed;         658 AA.
P52569; B7ZL54; O15291; O15292; Q14CQ6; Q6NSZ7; Q86TC6;
01-OCT-1996, integrated into UniProtKB/Swiss-Prot.
20-FEB-2007, sequence version 2.
27-SEP-2017, entry version 157.
RecName: Full=Cationic amino acid transporter 2;
Short=CAT-2;
Short=CAT2;
AltName: Full=Low affinity cationic amino acid transporter 2;
AltName: Full=Solute carrier family 7 member 2;
Name=SLC7A2; Synonyms=ATRC2, CAT2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND TISSUE SPECIFICITY.
TISSUE=Intestine;
PubMed=8954799; DOI=10.1006/geno.1996.0613;
Hoshide R., Ikeda Y., Karashima S., Matsuura T., Komaki S.,
Kishino T., Niikawa N., Endo F., Matsuda I.;
"Molecular cloning, tissue distribution, and chromosomal localization
of human cationic amino acid transporter 2 (HCAT2).";
Genomics 38:174-178(1996).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [MRNA] OF
337-469 (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, AND VARIANT
THR-531.
TISSUE=Liver;
PubMed=9174363; DOI=10.1021/bi962829p;
Closs E.I., Graef P., Habermeier A., Cunningham J.M., Foerstermann U.;
"Human cationic amino acid transporters hCAT-1, hCAT-2A, and hCAT-2B:
three related carriers with distinct transport properties.";
Biochemistry 36:6462-6468(1997).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16421571; DOI=10.1038/nature04406;
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S.,
Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A.,
Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X.,
Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T.,
Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K.,
DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G.,
Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B.,
Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P.,
Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H.,
Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C.,
O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K.,
Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R.,
Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K.,
Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q.,
Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N.,
Lander E.S.;
"DNA sequence and analysis of human chromosome 8.";
Nature 439:331-335(2006).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[5]
PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), AND
VARIANT THR-531.
TISSUE=Liver;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-658 (ISOFORM 2).
TISSUE=Skeletal muscle;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[7]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-646, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-455, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
Mann M.;
"Quantitative phosphoproteomics reveals widespread full
phosphorylation site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[9]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24; THR-28; SER-446;
SER-464; SER-646 AND SER-647, AND IDENTIFICATION BY MASS SPECTROMETRY
[LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[10]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-646, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
-!- FUNCTION: Functions as permease involved in the transport of the
cationic amino acids (arginine, lysine and ornithine); the
affinity for its substrates differs between isoforms created by
alternative splicing. Isoform 1 functions as permease that
mediates the transport of the cationic amino acids (arginine,
lysine and ornithine), and it has much higher affinity for
arginine than isoform 2. Isoform 2 functions as low-affinity, high
capacity permease involved in the transport of the cationic amino
acids (arginine, lysine and ornithine) (PubMed:9174363). May play
a role in classical or alternative activation of macrophages via
its role in arginine transport. {ECO:0000250|UniProtKB:P18581,
ECO:0000269|PubMed:9174363}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:9174363};
Multi-pass membrane protein {ECO:0000269|PubMed:9174363}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1; Synonyms=CAT-2B;
IsoId=P52569-1; Sequence=Displayed;
Name=2; Synonyms=CAT-2A;
IsoId=P52569-2; Sequence=VSP_037354, VSP_023354;
Note=Ref.2 (AAB62810) sequence differs from that shown due to a
frameshift in position 29. {ECO:0000305};
Name=3;
IsoId=P52569-3; Sequence=VSP_037354;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed at high levels in the skeletal
muscle, placenta and ovary. Expressed at intermediate levels in
the liver and pancreas and at low levels in the kidney and heart.
{ECO:0000269|PubMed:8954799}.
-!- SIMILARITY: Belongs to the amino acid-polyamine-organocation (APC)
superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3)
family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAH69648.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAI04906.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAI13662.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAI43584.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; D29990; BAA06271.1; -; mRNA.
EMBL; U76368; AAB62810.1; ALT_FRAME; mRNA.
EMBL; U76369; AAB62811.1; -; mRNA.
EMBL; AB020863; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471080; EAW63813.1; -; Genomic_DNA.
EMBL; BC069648; AAH69648.1; ALT_INIT; mRNA.
EMBL; BC104905; AAI04906.1; ALT_INIT; mRNA.
EMBL; BC113661; AAI13662.1; ALT_INIT; mRNA.
EMBL; BC143583; AAI43584.1; ALT_INIT; mRNA.
EMBL; AL832016; CAD89909.1; -; mRNA.
CCDS; CCDS34852.1; -. [P52569-1]
CCDS; CCDS55203.1; -. [P52569-3]
CCDS; CCDS6002.2; -. [P52569-2]
RefSeq; NP_001008539.3; NM_001008539.3. [P52569-1]
RefSeq; NP_001158243.1; NM_001164771.1. [P52569-3]
RefSeq; NP_003037.4; NM_003046.5. [P52569-2]
RefSeq; XP_005273667.1; XM_005273610.4. [P52569-1]
RefSeq; XP_005273668.1; XM_005273611.4. [P52569-1]
RefSeq; XP_005273669.1; XM_005273612.4. [P52569-1]
RefSeq; XP_016869235.1; XM_017013746.1. [P52569-1]
RefSeq; XP_016869236.1; XM_017013747.1.
UniGene; Hs.448520; -.
ProteinModelPortal; P52569; -.
BioGrid; 112433; 34.
IntAct; P52569; 2.
STRING; 9606.ENSP00000004531; -.
DrugBank; DB00123; L-Lysine.
DrugBank; DB00129; L-Ornithine.
TCDB; 2.A.3.3.8; the amino acid-polyamine-organocation (apc) family.
iPTMnet; P52569; -.
PhosphoSitePlus; P52569; -.
SwissPalm; P52569; -.
BioMuta; SLC7A2; -.
DMDM; 126302539; -.
EPD; P52569; -.
MaxQB; P52569; -.
PaxDb; P52569; -.
PeptideAtlas; P52569; -.
PRIDE; P52569; -.
Ensembl; ENST00000004531; ENSP00000004531; ENSG00000003989. [P52569-3]
Ensembl; ENST00000398090; ENSP00000381164; ENSG00000003989. [P52569-2]
Ensembl; ENST00000470360; ENSP00000419873; ENSG00000003989. [P52569-2]
Ensembl; ENST00000494857; ENSP00000419140; ENSG00000003989. [P52569-1]
Ensembl; ENST00000522656; ENSP00000430464; ENSG00000003989. [P52569-1]
GeneID; 6542; -.
KEGG; hsa:6542; -.
UCSC; uc011kyc.3; human. [P52569-1]
CTD; 6542; -.
DisGeNET; 6542; -.
EuPathDB; HostDB:ENSG00000003989.16; -.
GeneCards; SLC7A2; -.
HGNC; HGNC:11060; SLC7A2.
HPA; HPA009277; -.
MIM; 601872; gene.
neXtProt; NX_P52569; -.
OpenTargets; ENSG00000003989; -.
PharmGKB; PA35920; -.
eggNOG; KOG1286; Eukaryota.
eggNOG; COG0531; LUCA.
GeneTree; ENSGT00760000119151; -.
HOGENOM; HOG000250623; -.
HOVERGEN; HBG000280; -.
InParanoid; P52569; -.
KO; K13864; -.
OMA; SQVTMLQ; -.
OrthoDB; EOG091G05NM; -.
PhylomeDB; P52569; -.
TreeFam; TF315212; -.
Reactome; R-HSA-352230; Amino acid transport across the plasma membrane.
ChiTaRS; SLC7A2; human.
GeneWiki; SLC7A2; -.
GenomeRNAi; 6542; -.
PRO; PR:P52569; -.
Proteomes; UP000005640; Chromosome 8.
Bgee; ENSG00000003989; -.
CleanEx; HS_SLC7A2; -.
Genevisible; P52569; HS.
GO; GO:0030054; C:cell junction; IDA:HPA.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0016020; C:membrane; TAS:ProtInc.
GO; GO:0005886; C:plasma membrane; IDA:HPA.
GO; GO:0015171; F:amino acid transmembrane transporter activity; TAS:Reactome.
GO; GO:0015174; F:basic amino acid transmembrane transporter activity; TAS:ProtInc.
GO; GO:0005289; F:high-affinity arginine transmembrane transporter activity; IEA:Ensembl.
GO; GO:0097627; F:high-affinity L-ornithine transmembrane transporter activity; IEA:Ensembl.
GO; GO:0005292; F:high-affinity lysine transmembrane transporter activity; IEA:Ensembl.
GO; GO:0097626; F:low-affinity L-arginine transmembrane transporter activity; IEA:Ensembl.
GO; GO:0006865; P:amino acid transport; TAS:Reactome.
GO; GO:0006520; P:cellular amino acid metabolic process; TAS:ProtInc.
GO; GO:0097638; P:L-arginine import across plasma membrane; IEA:Ensembl.
GO; GO:0097639; P:L-lysine import across plasma membrane; IEA:Ensembl.
GO; GO:0097640; P:L-ornithine import across plasma membrane; IEA:Ensembl.
GO; GO:0042116; P:macrophage activation; IEA:Ensembl.
GO; GO:0006809; P:nitric oxide biosynthetic process; IEA:Ensembl.
GO; GO:0002537; P:nitric oxide production involved in inflammatory response; IEA:Ensembl.
GO; GO:0050727; P:regulation of inflammatory response; IEA:Ensembl.
GO; GO:0043030; P:regulation of macrophage activation; IEA:Ensembl.
GO; GO:0006810; P:transport; TAS:ProtInc.
InterPro; IPR002293; AA/rel_permease1.
InterPro; IPR004755; Cat_AA_permease.
InterPro; IPR029485; CAT_C.
Pfam; PF13520; AA_permease_2; 1.
Pfam; PF13906; AA_permease_C; 1.
TIGRFAMs; TIGR00906; 2A0303; 1.
1: Evidence at protein level;
Alternative splicing; Amino-acid transport; Cell membrane;
Complete proteome; Glycoprotein; Membrane; Phosphoprotein;
Polymorphism; Reference proteome; Transmembrane; Transmembrane helix;
Transport.
CHAIN 1 658 Cationic amino acid transporter 2.
/FTId=PRO_0000054264.
TOPO_DOM 1 37 Cytoplasmic. {ECO:0000255}.
TRANSMEM 38 59 Helical. {ECO:0000255}.
TOPO_DOM 60 63 Extracellular. {ECO:0000255}.
TRANSMEM 64 84 Helical. {ECO:0000255}.
TOPO_DOM 85 104 Cytoplasmic. {ECO:0000255}.
TRANSMEM 105 125 Helical. {ECO:0000255}.
TOPO_DOM 126 163 Extracellular. {ECO:0000255}.
TRANSMEM 164 184 Helical. {ECO:0000255}.
TOPO_DOM 185 192 Cytoplasmic. {ECO:0000255}.
TRANSMEM 193 213 Helical. {ECO:0000255}.
TOPO_DOM 214 248 Extracellular. {ECO:0000255}.
TRANSMEM 249 269 Helical. {ECO:0000255}.
TOPO_DOM 270 289 Cytoplasmic. {ECO:0000255}.
TRANSMEM 290 309 Helical. {ECO:0000255}.
TOPO_DOM 310 339 Extracellular. {ECO:0000255}.
TRANSMEM 340 360 Helical. {ECO:0000255}.
TOPO_DOM 361 386 Cytoplasmic. {ECO:0000255}.
TRANSMEM 387 407 Helical. {ECO:0000255}.
TOPO_DOM 408 410 Extracellular. {ECO:0000255}.
TRANSMEM 411 431 Helical. {ECO:0000255}.
TOPO_DOM 432 490 Cytoplasmic. {ECO:0000255}.
TRANSMEM 491 511 Helical. {ECO:0000255}.
TOPO_DOM 512 524 Extracellular. {ECO:0000255}.
TRANSMEM 525 549 Helical. {ECO:0000255}.
TOPO_DOM 550 557 Cytoplasmic. {ECO:0000255}.
TRANSMEM 558 578 Helical. {ECO:0000255}.
TOPO_DOM 579 582 Extracellular. {ECO:0000255}.
TRANSMEM 583 603 Helical. {ECO:0000255}.
TOPO_DOM 604 658 Cytoplasmic. {ECO:0000255}.
MOD_RES 24 24 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 28 28 Phosphothreonine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 446 446 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 455 455 Phosphoserine.
{ECO:0000244|PubMed:20068231}.
MOD_RES 464 464 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 646 646 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:23186163,
ECO:0000244|PubMed:24275569}.
MOD_RES 647 647 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
CARBOHYD 157 157 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 227 227 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 239 239 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 1 M -> MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPS
SDVRM (in isoform 2 and isoform 3).
{ECO:0000303|PubMed:17974005,
ECO:0000303|PubMed:9174363}.
/FTId=VSP_037354.
VAR_SEQ 357 398 IFPMPRVIYAMAEDGLLFKCLAQINSKTKTPIIATLSSGAV
A -> MFPLPRILFAMARDGLLFRFLARVSKRQSPVAATLT
AGVIS (in isoform 2).
{ECO:0000303|PubMed:17974005,
ECO:0000303|PubMed:9174363}.
/FTId=VSP_023354.
VARIANT 20 20 V -> M (in dbSNP:rs12680645).
/FTId=VAR_030799.
VARIANT 376 376 C -> F (in dbSNP:rs1134975).
/FTId=VAR_030800.
VARIANT 531 531 A -> T (in dbSNP:rs62622371).
{ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:9174363}.
/FTId=VAR_030801.
VARIANT 547 547 Q -> L (in dbSNP:rs1981498).
/FTId=VAR_058414.
CONFLICT 134 134 W -> G (in Ref. 1; BAA06271).
{ECO:0000305}.
CONFLICT 364 364 I -> N (in Ref. 1; BAA06271).
{ECO:0000305}.
CONFLICT 520 520 T -> Y (in Ref. 1; BAA06271).
{ECO:0000305}.
CONFLICT 552 552 Q -> R (in Ref. 1; BAA06271).
{ECO:0000305}.
CONFLICT 566 566 A -> T (in Ref. 1; BAA06271).
{ECO:0000305}.
CONFLICT 568 568 S -> T (in Ref. 1; BAA06271).
{ECO:0000305}.
CONFLICT 605 605 H -> R (in Ref. 6; CAD89909).
{ECO:0000305}.
CONFLICT 619 619 D -> V (in Ref. 6; CAD89909).
{ECO:0000305}.
SEQUENCE 658 AA; 71673 MW; 633FD86A333E9208 CRC64;
MIPCRAALTF ARCLIRRKIV TLDSLEDTKL CRCLSTMDLI ALGVGSTLGA GVYVLAGEVA
KADSGPSIVV SFLIAALASV MAGLCYAEFG ARVPKTGSAY LYTYVTVGEL WAFITGWNLI
LSYVIGTSSV ARAWSGTFDE LLSKQIGQFL RTYFRMNYTG LAEYPDFFAV CLILLLAGLL
SFGVKESAWV NKVFTAVNIL VLLFVMVAGF VKGNVANWKI SEEFLKNISA SAREPPSENG
TSIYGAGGFM PYGFTGTLAG AATCFYAFVG FDCIATTGEE VRNPQKAIPI GIVTSLLVCF
MAYFGVSAAL TLMMPYYLLD EKSPLPVAFE YVGWGPAKYV VAAGSLCALS TSLLGSIFPM
PRVIYAMAED GLLFKCLAQI NSKTKTPIIA TLSSGAVAAL MAFLFDLKAL VDMMSIGTLM
AYSLVAACVL ILRYQPGLSY DQPKCSPEKD GLGSSPRVTS KSESQVTMLQ RQGFSMRTLF
CPSLLPTQQS ASLVSFLVGF LAFLVLGLSV LTTYGVHAIT RLEAWSLALL ALFLVLFVAI
VLTIWRQPQN QQKVAFMVPF LPFLPAFSIL VNIYLMVQLS ADTWVRFSIW MAIGFLIYFS
YGIRHSLEGH LRDENNEEDA YPDNVHAAAE EKSAIQANDH HPRNLSSPFI FHEKTSEF


Related products :

Catalog number Product name Quantity
EIAAB09877 Atrc2,CAT2,Cat2,CAT-2,Low affinity cationic amino acid transporter 2,Rat,Rattus norvegicus,Slc7a2,Solute carrier family 7 member 2
EIAAB09873 ATRC2,CAT2,CAT2,CAT-2,Homo sapiens,Human,Low affinity cationic amino acid transporter 2,SLC7A2,Solute carrier family 7 member 2
EIAAB09878 ATRC2,CAT2,CAT-2,Low affinity cationic amino acid transporter 2,Pig,SLC7A2,Solute carrier family 7 member 2,Sus scrofa
EIAAB09874 ATRC2,CAT2,CAT2,CAT-2,cCAT-2,Chicken,Gallus gallus,Low affinity cationic amino acid transporter 2,SLC7A2,Solute carrier family 7 member 2
EIAAB46686 Cationic amino acid transporter, y+ system,Homo sapiens,Human,KIAA0245,SLC7A6,Solute carrier family 7 member 6,y(+)L-type amino acid transporter 2,Y+L amino acid transporter 2,Y+LAT2,y+LAT-2
EIAAB09879 ATRC3,CAT3,CAT3,CAT-3,Cationic amino acid transporter 3,Cationic amino acid transporter y+,Homo sapiens,Human,SLC7A3,Solute carrier family 7 member 3
EIAAB09880 Atrc3,CAT3,Cat3,CAT-3,Cationic amino acid transporter 3,Cationic amino acid transporter y+,Rat,Rattus norvegicus,Slc7a3,Solute carrier family 7 member 3
EIAAB09881 Atrc3,CAT3,Cat3,CAT-3,Cationic amino acid transporter 3,Cationic amino acid transporter y+,Mouse,Mus musculus,Slc7a3,Solute carrier family 7 member 3
EIAAB09876 20.5,Atrc2,CAT2,CAT-2,Low affinity cationic amino acid transporter 2,Mouse,Mus musculus,Slc7a2,Solute carrier family 7 member 2,T-cell early activation protein,TEA,Tea
201-20-5413 SLC7A4{solute carrier family 7 (cationic amino acid transporter, y+ system), member 4}rabbit.pAb 0.2ml
201-20-5412 SLC7A1{solute carrier family 7 (cationic amino acid transporter, y+ system), member 1}rabbit.pAb 0.2ml
201-20-5414 SLC7A5{solute carrier family 7 (cationic amino acid transporter, y+ system), member 5}rabbit.pAb 0.2ml
E1389054 Cat Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 2 (SLC7A2) ELISA Kit
Y105453 Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 11 (SLC7A11), Human 50ug
Y105450 Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 5 (Slc7a5), Human 50ug
Y105451 Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 5 (Slc7a5), Human 50ug
18-783-75522 RABBIT ANTI HUMAN CD98 LIGHT CHAIN (N-TERMINAL) - 4F2 LIGHT CHAIN; L-type amino acid transporter 1; Solute carrier family 7 member 5; y+ system cationic amino acid transporter; 4F2 light chain; 4F2 LC 0.05 mg
Y105453 Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 11 (SLC7A11), Human Antibody 50ug
GWB-97FE81 Anti- SLC7A4 (solute carrier family 7 (cationic amino acid transporter. y+ system). member 4) Antibody
Y105450 Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 5 (Slc7a5), Human Antibody 50ug
GWB-FB1D5B Anti- SLC7A14 (solute carrier family 7 (cationic amino acid transporter. y+ system). member 14) Antibody
EIAAB09882 CAT4,CAT-4,Cationic amino acid transporter 4,Mouse,Mus musculus,Slc7a4,Solute carrier family 7 member 4
Y105451 Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 5 (Slc7a5), Human Antibody 50ug
EIAAB37161 Bos taurus,Bovine,Probable cationic amino acid transporter,SLC7A14,Solute carrier family 7 member 14
GWB-B7DA5E Anti- Solute Carrier Family 7 (Cationic Amino Acid Transporter Y+ System) Member 5 (Slc7a5) Human Antibody


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur