Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Cell surface glycoprotein MUC18 (Cell surface glycoprotein P1H12) (Melanoma cell adhesion molecule) (Melanoma-associated antigen A32) (Melanoma-associated antigen MUC18) (S-endo 1 endothelial-associated antigen) (CD antigen CD146)

 MUC18_HUMAN             Reviewed;         646 AA.
P43121; O95812; Q59E86; Q6PHR3; Q6ZTR2;
01-NOV-1995, integrated into UniProtKB/Swiss-Prot.
10-JAN-2006, sequence version 2.
18-JUL-2018, entry version 166.
RecName: Full=Cell surface glycoprotein MUC18;
AltName: Full=Cell surface glycoprotein P1H12;
AltName: Full=Melanoma cell adhesion molecule;
AltName: Full=Melanoma-associated antigen A32;
AltName: Full=Melanoma-associated antigen MUC18;
AltName: Full=S-endo 1 endothelial-associated antigen;
AltName: CD_antigen=CD146;
Flags: Precursor;
Name=MCAM; Synonyms=MUC18;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Melanoma;
PubMed=2602381; DOI=10.1073/pnas.86.24.9891;
Lehmann J.M., Riethmueller G., Johnson J.P.;
"MUC18, a marker of tumor progression in human melanoma, shows
sequence similarity to the neural cell adhesion molecules of the
immunoglobulin superfamily.";
Proc. Natl. Acad. Sci. U.S.A. 86:9891-9895(1989).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), AND SEQUENCE
REVISION.
TISSUE=Melanoma;
PubMed=8378324; DOI=10.1073/pnas.90.18.8514;
Sers C., Kirsch K., Rothbaecher U., Riethmueller G., Johnson J.P.;
"Genomic organization of the melanoma-associated glycoprotein MUC18:
implications for the evolution of the immunoglobulin domains.";
Proc. Natl. Acad. Sci. U.S.A. 90:8514-8518(1993).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=11709656; DOI=10.1067/mlc.2001.118519;
Solovey A.N., Gui L., Chang L., Enenstein J., Browne P.V.,
Hebbel R.P.;
"Identification and functional assessment of endothelial P1H12.";
J. Lab. Clin. Med. 138:322-331(2001).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Trachea;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
GLY-89.
TISSUE=Aortic endothelium;
Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.,
Ohara O., Nagase T., Kikuno R.F.;
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=PNS;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
PROTEIN SEQUENCE OF 24-44; 98-112; 135-153; 240-260; 379-389 AND
460-478.
PubMed=8162602;
Shih I.-M., Eleder D.E., Speicher D., Johnson J.P., Herlyn M.;
"Isolation and functional characterization of the A32 melanoma-
associated antigen.";
Cancer Res. 54:2514-2520(1994).
[8]
PROTEIN SEQUENCE OF 27-40; 98-112 AND 236-260.
PubMed=8573133; DOI=10.1006/bbrc.1996.0037;
Bardin N., Frances V., Lesaule G., Horschowski N., George F.,
Sampol J.;
"Identification of the S-endo 1 endothelial-associated antigen.";
Biochem. Biophys. Res. Commun. 218:210-216(1996).
[9]
FUNCTION.
PubMed=8292890;
Johnson J.P., Rothbacher U., Sers C.;
"The progression associated antigen MUC18: a unique member of the
immunoglobulin supergene family.";
Melanoma Res. 3:337-340(1993).
[10]
FUNCTION.
PubMed=11036077; DOI=10.1074/jbc.M007065200;
Anfosso F., Bardin N., Vivier E., Sabatier F., Sampol J.,
Dignat-George F.;
"Outside-in signaling pathway linked to CD146 engagement in human
endothelial cells.";
J. Biol. Chem. 276:1564-1569(2001).
[11]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-614, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[12]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-467.
TISSUE=Liver;
PubMed=19159218; DOI=10.1021/pr8008012;
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
"Glycoproteomics analysis of human liver tissue by combination of
multiple enzyme digestion and hydrazide chemistry.";
J. Proteome Res. 8:651-661(2009).
[13]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-614 AND SER-628, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
Mann M.;
"Quantitative phosphoproteomics reveals widespread full
phosphorylation site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[14]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
-!- FUNCTION: Plays a role in cell adhesion, and in cohesion of the
endothelial monolayer at intercellular junctions in vascular
tissue. Its expression may allow melanoma cells to interact with
cellular elements of the vascular system, thereby enhancing
hematogeneous tumor spread. Could be an adhesion molecule active
in neural crest cells during embryonic development. Acts as
surface receptor that triggers tyrosine phosphorylation of FYN and
PTK2/FAK1, and a transient increase in the intracellular calcium
concentration. {ECO:0000269|PubMed:11036077,
ECO:0000269|PubMed:8292890}.
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane
protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P43121-1; Sequence=Displayed;
Name=2;
IsoId=P43121-2; Sequence=VSP_016938, VSP_016939;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Detected in endothelial cells in vascular
tissue throughout the body. May appear at the surface of neural
crest cells during their embryonic migration. Appears to be
limited to vascular smooth muscle in normal adult tissues.
Associated with tumor progression and the development of
metastasis in human malignant melanoma. Expressed most strongly on
metastatic lesions and advanced primary tumors and is only rarely
detected in benign melanocytic nevi and thin primary melanomas
with a low probability of metastasis.
-!- SEQUENCE CAUTION:
Sequence=BAD93162.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
URL="http://atlasgeneticsoncology.org/Genes/MCAMID41314ch11q23.html";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; M29277; AAA20824.1; -; mRNA.
EMBL; M28882; AAA20922.1; -; mRNA.
EMBL; X68264; CAA48332.1; -; Genomic_DNA.
EMBL; X68265; CAA48332.1; JOINED; Genomic_DNA.
EMBL; X68266; CAA48332.1; JOINED; Genomic_DNA.
EMBL; X68267; CAA48332.1; JOINED; Genomic_DNA.
EMBL; X68268; CAA48332.1; JOINED; Genomic_DNA.
EMBL; X68270; CAA48332.1; JOINED; Genomic_DNA.
EMBL; X68271; CAA48332.1; JOINED; Genomic_DNA.
EMBL; AF089868; AAD17799.1; -; mRNA.
EMBL; AK126303; BAC86520.1; -; mRNA.
EMBL; AB209925; BAD93162.1; ALT_INIT; mRNA.
EMBL; BC056418; AAH56418.1; -; mRNA.
CCDS; CCDS31690.1; -. [P43121-1]
PIR; I38049; I38049.
RefSeq; NP_006491.2; NM_006500.2. [P43121-1]
UniGene; Hs.599039; -.
ProteinModelPortal; P43121; -.
BioGrid; 110332; 15.
DIP; DIP-52791N; -.
IntAct; P43121; 8.
MINT; P43121; -.
STRING; 9606.ENSP00000264036; -.
ChEMBL; CHEMBL3712863; -.
GuidetoPHARMACOLOGY; 2988; -.
iPTMnet; P43121; -.
PhosphoSitePlus; P43121; -.
SwissPalm; P43121; -.
BioMuta; MCAM; -.
DMDM; 85681878; -.
EPD; P43121; -.
MaxQB; P43121; -.
PaxDb; P43121; -.
PeptideAtlas; P43121; -.
PRIDE; P43121; -.
ProteomicsDB; 55589; -.
ProteomicsDB; 55590; -. [P43121-2]
DNASU; 4162; -.
Ensembl; ENST00000264036; ENSP00000264036; ENSG00000076706. [P43121-1]
GeneID; 4162; -.
KEGG; hsa:4162; -.
UCSC; uc001pwf.4; human. [P43121-1]
CTD; 4162; -.
DisGeNET; 4162; -.
EuPathDB; HostDB:ENSG00000076706.14; -.
GeneCards; MCAM; -.
HGNC; HGNC:6934; MCAM.
HPA; CAB002147; -.
HPA; HPA008848; -.
MIM; 155735; gene.
neXtProt; NX_P43121; -.
OpenTargets; ENSG00000076706; -.
PharmGKB; PA30678; -.
eggNOG; ENOG410IEC2; Eukaryota.
eggNOG; ENOG4110RPG; LUCA.
GeneTree; ENSGT00530000063457; -.
HOGENOM; HOG000015427; -.
HOVERGEN; HBG002808; -.
InParanoid; P43121; -.
KO; K06534; -.
OMA; GDQGEKY; -.
OrthoDB; EOG091G072E; -.
PhylomeDB; P43121; -.
TreeFam; TF330534; -.
ChiTaRS; MCAM; human.
GeneWiki; CD146; -.
GenomeRNAi; 4162; -.
PRO; PR:P43121; -.
Proteomes; UP000005640; Chromosome 11.
Bgee; ENSG00000076706; -.
CleanEx; HS_MCAM; -.
ExpressionAtlas; P43121; baseline and differential.
Genevisible; P43121; HS.
GO; GO:0009897; C:external side of plasma membrane; IDA:UniProtKB.
GO; GO:0005576; C:extracellular region; HDA:BHF-UCL.
GO; GO:0005615; C:extracellular space; IEA:Ensembl.
GO; GO:0005925; C:focal adhesion; HDA:UniProtKB.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005634; C:nucleus; IEA:Ensembl.
GO; GO:0005886; C:plasma membrane; NAS:ProtInc.
GO; GO:0009653; P:anatomical structure morphogenesis; TAS:ProtInc.
GO; GO:0001525; P:angiogenesis; IDA:MGI.
GO; GO:0007155; P:cell adhesion; TAS:ProtInc.
GO; GO:0003094; P:glomerular filtration; IEP:UniProtKB.
GO; GO:0030335; P:positive regulation of cell migration; IEA:Ensembl.
GO; GO:0061042; P:vascular wound healing; IEP:UniProtKB.
Gene3D; 2.60.40.10; -; 5.
InterPro; IPR013162; CD80_C2-set.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
InterPro; IPR003598; Ig_sub2.
InterPro; IPR013106; Ig_V-set.
InterPro; IPR013151; Immunoglobulin.
Pfam; PF08205; C2-set_2; 1.
Pfam; PF00047; ig; 1.
Pfam; PF07686; V-set; 1.
SMART; SM00409; IG; 5.
SMART; SM00408; IGc2; 3.
SUPFAM; SSF48726; SSF48726; 5.
PROSITE; PS50835; IG_LIKE; 5.
1: Evidence at protein level;
Alternative splicing; Cell adhesion; Complete proteome;
Direct protein sequencing; Disulfide bond; Glycoprotein;
Immunoglobulin domain; Membrane; Phosphoprotein; Polymorphism;
Reference proteome; Repeat; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1 23 {ECO:0000269|PubMed:8162602}.
CHAIN 24 646 Cell surface glycoprotein MUC18.
/FTId=PRO_0000014891.
TOPO_DOM 24 559 Extracellular. {ECO:0000255}.
TRANSMEM 560 583 Helical. {ECO:0000255}.
TOPO_DOM 584 646 Cytoplasmic. {ECO:0000255}.
DOMAIN 24 129 Ig-like V-type 1.
DOMAIN 139 242 Ig-like V-type 2.
DOMAIN 244 330 Ig-like C2-type 1.
DOMAIN 335 424 Ig-like C2-type 2.
DOMAIN 430 510 Ig-like C2-type 3.
MOD_RES 606 606 Phosphoserine.
{ECO:0000250|UniProtKB:Q8R2Y2}.
MOD_RES 614 614 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231}.
MOD_RES 628 628 Phosphoserine.
{ECO:0000244|PubMed:20068231}.
CARBOHYD 56 56 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 418 418 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 449 449 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 467 467 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:19159218}.
CARBOHYD 508 508 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 518 518 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 527 527 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 544 544 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 48 116 {ECO:0000305}.
DISULFID 161 223 {ECO:0000305}.
DISULFID 272 320 {ECO:0000305}.
DISULFID 365 407 {ECO:0000305}.
DISULFID 452 499 {ECO:0000305}.
VAR_SEQ 1 187 MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVG
STALLKCGLSQSQGNLSHVDWFSVHKEKRTLIFRVRQGQGQ
SEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPRS
QEYRIQLRVYKAPEEPNIQVNPLGIPVNSKEPEEVATCVGR
NGYPIPQVIWYKNGRPLKEEKNR -> MVYIVRQFLLYNVS
GSVYLDQLIVLLTAKFSILRIAGSRVHHSPFSGHLDGCSFL
SLQHSLHTSLDMSRHENVFLGLTLSSKSAGLKGFQLAFVPG
LLQGTGGYLDGPLPTPVDNPRVGLEVGLRLSLPPLPPCPG
(in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_016938.
VAR_SEQ 549 646 ERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLP
CRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGD
KRAPGDQGEKYIDLRH -> GKPGLAREQGCARASFLPCPS
PESPVQKGE (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_016939.
VARIANT 89 89 E -> G (in dbSNP:rs34587557).
{ECO:0000269|Ref.5}.
/FTId=VAR_049915.
CONFLICT 322 324 GLD -> AWN (in Ref. 1 and 2).
{ECO:0000305}.
CONFLICT 383 383 G -> D (in Ref. 1, 2 and 3).
{ECO:0000305}.
CONFLICT 424 425 NV -> KL (in Ref. 1 and 2).
{ECO:0000305}.
CONFLICT 606 606 S -> T (in Ref. 1 and 2). {ECO:0000305}.
SEQUENCE 646 AA; 71607 MW; E46CB8AC7BA0738E CRC64;
MGLPRLVCAF LLAACCCCPR VAGVPGEAEQ PAPELVEVEV GSTALLKCGL SQSQGNLSHV
DWFSVHKEKR TLIFRVRQGQ GQSEPGEYEQ RLSLQDRGAT LALTQVTPQD ERIFLCQGKR
PRSQEYRIQL RVYKAPEEPN IQVNPLGIPV NSKEPEEVAT CVGRNGYPIP QVIWYKNGRP
LKEEKNRVHI QSSQTVESSG LYTLQSILKA QLVKEDKDAQ FYCELNYRLP SGNHMKESRE
VTVPVFYPTE KVWLEVEPVG MLKEGDRVEI RCLADGNPPP HFSISKQNPS TREAEEETTN
DNGVLVLEPA RKEHSGRYEC QGLDLDTMIS LLSEPQELLV NYVSDVRVSP AAPERQEGSS
LTLTCEAESS QDLEFQWLRE ETGQVLERGP VLQLHDLKRE AGGGYRCVAS VPSIPGLNRT
QLVNVAIFGP PWMAFKERKV WVKENMVLNL SCEASGHPRP TISWNVNGTA SEQDQDPQRV
LSTLNVLVTP ELLETGVECT ASNDLGKNTS ILFLELVNLT TLTPDSNTTT GLSTSTASPH
TRANSTSTER KLPEPESRGV VIVAVIVCIL VLAVLGAVLY FLYKKGKLPC RRSGKQEITL
PPSRKSELVV EVKSDKLPEE MGLLQGSSGD KRAPGDQGEK YIDLRH


Related products :

Catalog number Product name Quantity
E1670h ELISA Cell surface glycoprotein MUC18,Cell surface glycoprotein P1H12,Homo sapiens,Human,MCAM,Melanoma cell adhesion molecule,Melanoma-associated antigen A32,Melanoma-associated antigen MUC18,MUC18,S- 96T
U1670h CLIA Cell surface glycoprotein MUC18,Cell surface glycoprotein P1H12,Homo sapiens,Human,MCAM,Melanoma cell adhesion molecule,Melanoma-associated antigen A32,Melanoma-associated antigen MUC18,MUC18,S-e 96T
20-272-190481 CD146 - Mouse monoclonal [P1H12] to CD146; Melanoma-associated antigen MUC18; Melanoma cell adhesion molecule; Melanoma-associated antigen A32; S-endo 1 endothelial-associated antigen; Cell surface gl 0.05 ml
E1670h ELISA kit Cell surface glycoprotein MUC18,Cell surface glycoprotein P1H12,Homo sapiens,Human,MCAM,Melanoma cell adhesion molecule,Melanoma-associated antigen A32,Melanoma-associated antigen MUC18,MUC 96T
E1670r ELISA kit Cell surface glycoprotein MUC18,Gicerin,Mcam,Melanoma cell adhesion molecule,Melanoma-associated antigen MUC18,Muc18,Rat,Rattus norvegicus 96T
E1670m ELISA Cell surface glycoprotein MUC18,Gicerin,Mcam,Melanoma cell adhesion molecule,Melanoma-associated antigen MUC18,Mouse,Muc18,Mus musculus 96T
E1670r ELISA Cell surface glycoprotein MUC18,Gicerin,Mcam,Melanoma cell adhesion molecule,Melanoma-associated antigen MUC18,Muc18,Rat,Rattus norvegicus 96T
U1670r CLIA Cell surface glycoprotein MUC18,Gicerin,Mcam,Melanoma cell adhesion molecule,Melanoma-associated antigen MUC18,Muc18,Rat,Rattus norvegicus 96T
E1670m ELISA kit Cell surface glycoprotein MUC18,Gicerin,Mcam,Melanoma cell adhesion molecule,Melanoma-associated antigen MUC18,Mouse,Muc18,Mus musculus 96T
U1670m CLIA Cell surface glycoprotein MUC18,Gicerin,Mcam,Melanoma cell adhesion molecule,Melanoma-associated antigen MUC18,Mouse,Muc18,Mus musculus 96T
20-272-190290 CD146 - Mouse monoclonal [OJ79c MUC 18] to CD146; Melanoma-associated antigen MUC18; Melanoma cell adhesion molecule; Melanoma-associated antigen A32; S-endo 1 endothelial-associated antigen; Cell sur 0.1 mg
20-272-191634 CD146 (FITC) - Mouse monoclonal [2Q401] to CD146 (FITC); Melanoma-associated antigen MUC18; Melanoma cell adhesion molecule; Melanoma-associated antigen A32; S-endo 1 endothelial-associated antigen; C 0.025 mg
E1283h ELISA kit Adenocarcinoma-associated antigen,Cell surface glycoprotein Trop-1,EGP,EGP314,EPCAM,Ep-CAM,Epithelial cell adhesion molecule,Epithelial cell surface antigen,Epithelial glycoprotein,Epitheli 96T
MEDCLA899-01 CD146, MUC18, A32 Antigen, S_Endo_1, Melanoma Cell Adhes Mol (MCAM_Mel_CAM), Clone N1238, Mab anti_Human; prfn, IH_WB 0.1 ml.
MEDCLA899-1 CD146, MUC18, A32 Antigen, S_Endo_1, Melanoma Cell Adhes Mol (MCAM_Mel_CAM), Clone N1238, Mab anti_Human; prfn, IH_WB 1 ml.
U1283h CLIA Adenocarcinoma-associated antigen,Cell surface glycoprotein Trop-1,EGP,EGP314,EPCAM,Ep-CAM,Epithelial cell adhesion molecule,Epithelial cell surface antigen,Epithelial glycoprotein,Epithelial gly 96T
E1283h ELISA Adenocarcinoma-associated antigen,Cell surface glycoprotein Trop-1,EGP,EGP314,EPCAM,Ep-CAM,Epithelial cell adhesion molecule,Epithelial cell surface antigen,Epithelial glycoprotein,Epithelial gl 96T
EIAAB06400 Cd8b,Cd8b1,Ly-3,Lymphocyte antigen 3,Lyt3,Lyt-3,Mouse,Mus musculus,T-cell membrane glycoprotein Ly-3,T-cell surface glycoprotein CD8 beta chain,T-cell surface glycoprotein Lyt-3
U1014m CLIA Cd4,Mouse,Mus musculus,T-cell differentiation antigen L3T4,T-cell surface antigen T4_Leu-3,T-cell surface glycoprotein CD4 96T
E1014m ELISA Cd4,Mouse,Mus musculus,T-cell differentiation antigen L3T4,T-cell surface antigen T4_Leu-3,T-cell surface glycoprotein CD4 96T
E1014m ELISA kit Cd4,Mouse,Mus musculus,T-cell differentiation antigen L3T4,T-cell surface antigen T4_Leu-3,T-cell surface glycoprotein CD4 96T
E1014r ELISA Cd4,Rat,Rattus norvegicus,T-cell surface antigen T4_Leu-3,T-cell surface glycoprotein CD4,W3_25 antigen 96T
U1014r CLIA Cd4,Rat,Rattus norvegicus,T-cell surface antigen T4_Leu-3,T-cell surface glycoprotein CD4,W3_25 antigen 96T
E1014r ELISA kit Cd4,Rat,Rattus norvegicus,T-cell surface antigen T4_Leu-3,T-cell surface glycoprotein CD4,W3_25 antigen 96T
20-783-70111 RAT ANTI MOUSE CD8 Azide Free - LY-2; T-cell surface glycoprotein Lyt-3; T-cell membrane glycoprotein Ly-3; Lymphocyte antigen 3; CD8b antigen Monoclonal 1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur