Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Centrosomal protein of 63 kDa (Cep63)

 CEP63_HUMAN             Reviewed;         703 AA.
Q96MT8; D3DND8; D3DND9; D3DNE0; Q96CR0; Q9H8F5; Q9H8N0;
21-DEC-2004, integrated into UniProtKB/Swiss-Prot.
01-DEC-2001, sequence version 1.
10-OCT-2018, entry version 133.
RecName: Full=Centrosomal protein of 63 kDa;
Short=Cep63;
Name=CEP63;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
TISSUE=Placenta, and Teratocarcinoma;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
TISSUE=Pancreas;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
IDENTIFICATION (ISOFORM 3), AND SUBCELLULAR LOCATION [LARGE SCALE
ANALYSIS].
TISSUE=Lymphoblast;
PubMed=14654843; DOI=10.1038/nature02166;
Andersen J.S., Wilkinson C.J., Mayor T., Mortensen P., Nigg E.A.,
Mann M.;
"Proteomic characterization of the human centrosome by protein
correlation profiling.";
Nature 426:570-574(2003).
[5]
FUNCTION, INTERACTION WITH CDK1 AND CDK2, AND SUBCELLULAR LOCATION.
PubMed=21406398; DOI=10.1158/0008-5472.CAN-10-2684;
Loffler H., Fechter A., Matuszewska M., Saffrich R., Mistrik M.,
Marhold J., Hornung C., Westermann F., Bartek J., Kramer A.;
"Cep63 recruits Cdk1 to the centrosome: implications for regulation of
mitotic entry, centrosome amplification, and genome maintenance.";
Cancer Res. 71:2129-2139(2011).
[6]
INVOLVEMENT IN SCKL6, FUNCTION, INTERACTION WITH CEP152, AND
SUBCELLULAR LOCATION.
PubMed=21983783; DOI=10.1038/ng.971;
Sir J.H., Barr A.R., Nicholas A.K., Carvalho O.P., Khurshid M.,
Sossick A., Reichelt S., D'Santos C., Woods C.G., Gergely F.;
"A primary microcephaly protein complex forms a ring around parental
centrioles.";
Nat. Genet. 43:1147-1153(2011).
[7]
ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=22814378; DOI=10.1073/pnas.1210303109;
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A.,
Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E.,
Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K.,
Aldabe R.;
"N-terminal acetylome analyses and functional insights of the N-
terminal acetyltransferase NatB.";
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-278, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[9]
SUBCELLULAR LOCATION, AND INTERACTION WITH CCDC14 AND KIAA0753.
PubMed=24613305; DOI=10.1016/j.cub.2014.01.067;
Firat-Karalar E.N., Rauniyar N., Yates J.R. III, Stearns T.;
"Proximity interactions among centrosome components identify
regulators of centriole duplication.";
Curr. Biol. 24:664-670(2014).
[10]
FUNCTION, INTERACTION WITH CDK5RAP2; CEP152; WDR62; CEP90; CCDC14 AND
CDK2, AND SUBCELLULAR LOCATION.
PubMed=26297806; DOI=10.7554/eLife.07519;
Kodani A., Yu T.W., Johnson J.R., Jayaraman D., Johnson T.L.,
Al-Gazali L., Sztriha L., Partlow J.N., Kim H., Krup A.L.,
Dammermann A., Krogan N., Walsh C.A., Reiter J.F.;
"Centriolar satellites assemble centrosomal microcephaly proteins to
recruit CDK2 and promote centriole duplication.";
Elife 4:0-0(2015).
-!- FUNCTION: Required for normal spindle assembly. Plays a key role
in mother-centriole-dependent centriole duplication; the function
seems also to involve CEP152, CDK5RAP2 and WDR62 through a
stepwise assembled complex at the centrosome that recruits CDK2
required for centriole duplication. Reported to be required for
centrosomal recruitment of CEP152; however, this function has been
questioned (PubMed:21983783, PubMed:26297806). Also recruits CDK1
to centrosomes (PubMed:21406398). Plays a role in DNA damage
response. Following DNA damage, such as double-strand breaks
(DSBs), is removed from centrosomes; this leads to the
inactivation of spindle assembly and delay in mitotic progression
(PubMed:21406398). {ECO:0000269|PubMed:21406398,
ECO:0000269|PubMed:21983783, ECO:0000269|PubMed:26297806}.
-!- SUBUNIT: Interacts with CEP152 and CDK1; these interactions
recruit both ligands to centrosomes (PubMed:21406398). Interacts
with CDK2, CDK5RAP2, WDR62, CEP90, KIAA0753/moonraker and CCDC14.
CEP63, CDK5RAP2, CEP152, WDR62 are proposed to form a stepwise
assembled complex at the centrosome forming a ring near parental
centrioles (PubMed:21406398, PubMed:26297806).
{ECO:0000269|PubMed:21406398, ECO:0000269|PubMed:21983783,
ECO:0000269|PubMed:26297806}.
-!- INTERACTION:
P09917:ALOX5; NbExp=5; IntAct=EBI-11522539, EBI-79934;
P53365:ARFIP2; NbExp=3; IntAct=EBI-741977, EBI-638194;
Q49A88:CCDC14; NbExp=5; IntAct=EBI-741977, EBI-751035;
A2AUM9:Cep152 (xeno); NbExp=3; IntAct=EBI-741977, EBI-2554268;
Q86XR8:CEP57; NbExp=3; IntAct=EBI-741977, EBI-308614;
Q86XR8-3:CEP57; NbExp=3; IntAct=EBI-11522539, EBI-11752486;
Q8IYX8:CEP57L1; NbExp=3; IntAct=EBI-741977, EBI-1104570;
Q8IYX8-2:CEP57L1; NbExp=3; IntAct=EBI-741977, EBI-10181988;
Q9NRI5:DISC1; NbExp=7; IntAct=EBI-741977, EBI-529989;
O60941:DTNB; NbExp=4; IntAct=EBI-741977, EBI-740402;
Q86Y13:DZIP3; NbExp=3; IntAct=EBI-741977, EBI-948630;
Q15910:EZH2; NbExp=3; IntAct=EBI-741977, EBI-530054;
Q3B820:FAM161A; NbExp=3; IntAct=EBI-741977, EBI-719941;
Q8TES7-6:FBF1; NbExp=3; IntAct=EBI-741977, EBI-10244131;
Q96CS2:HAUS1; NbExp=4; IntAct=EBI-741977, EBI-2514791;
O14964:HGS; NbExp=5; IntAct=EBI-11522539, EBI-740220;
Q9NPJ8:NXT2; NbExp=3; IntAct=EBI-741977, EBI-752122;
Q8WXW3:PIBF1; NbExp=6; IntAct=EBI-741977, EBI-2558770;
Q9BT08:POLR3C; NbExp=3; IntAct=EBI-741977, EBI-10297880;
Q969G3:SMARCE1; NbExp=4; IntAct=EBI-741977, EBI-455078;
Q99909:SSX3; NbExp=3; IntAct=EBI-741977, EBI-10295431;
Q9BSW7:SYT17; NbExp=3; IntAct=EBI-741977, EBI-745392;
Q92844:TANK; NbExp=4; IntAct=EBI-741977, EBI-356349;
P03410:tax (xeno); NbExp=4; IntAct=EBI-741977, EBI-9676218;
P14079:tax (xeno); NbExp=5; IntAct=EBI-741977, EBI-9675698;
Q8TC07:TBC1D15; NbExp=5; IntAct=EBI-741977, EBI-1048247;
Q63HK5:TSHZ3; NbExp=3; IntAct=EBI-741977, EBI-9053916;
P40222:TXLNA; NbExp=4; IntAct=EBI-741977, EBI-359793;
Q8N3L3:TXLNB; NbExp=3; IntAct=EBI-741977, EBI-6116822;
Q8TBK6:ZCCHC10; NbExp=3; IntAct=EBI-741977, EBI-597063;
-!- SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton, microtubule
organizing center, centrosome {ECO:0000269|PubMed:26297806}.
Cytoplasm, cytoskeleton, microtubule organizing center,
centrosome, centriole {ECO:0000269|PubMed:21983783,
ECO:0000269|PubMed:26297806}. Cytoplasm, cytoskeleton, microtubule
organizing center, centrosome, centriolar satellite
{ECO:0000269|PubMed:24613305}. Note=Colocalizes with CDK5RAP2,
CEP152 and WDR62 in a discrete ring around the proximal end of the
parental centriole. At this site, a cohesive structure is
predicted to engage parental centrioles and procentrioles.
{ECO:0000269|PubMed:21983783, ECO:0000269|PubMed:26297806}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q96MT8-1; Sequence=Displayed;
Name=2;
IsoId=Q96MT8-2; Sequence=VSP_012252;
Name=3;
IsoId=Q96MT8-3; Sequence=VSP_012251, VSP_012252;
Name=4;
IsoId=Q96MT8-4; Sequence=VSP_012251, VSP_012253, VSP_012254;
-!- DISEASE: Seckel syndrome 6 (SCKL6) [MIM:614728]: A rare autosomal
recessive disorder characterized by proportionate dwarfism of
prenatal onset associated with low birth weight, growth
retardation, severe microcephaly with a bird-headed like
appearance, and mental retardation. {ECO:0000269|PubMed:21983783}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-!- MISCELLANEOUS: CEP63 and DEUP1 paralogs are both involved in
centriole amplification: while CEP63 mediates mother-centriole-
dependent centriole duplication, DEUP1 mediates de novo centriole
amplification in multiciliated cells.
-!- SIMILARITY: Belongs to the CEP63 family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AK023448; BAB14578.1; -; mRNA.
EMBL; AK023738; BAB14662.1; -; mRNA.
EMBL; AK056465; BAB71192.1; -; mRNA.
EMBL; CH471052; EAW79136.1; -; Genomic_DNA.
EMBL; CH471052; EAW79137.1; -; Genomic_DNA.
EMBL; CH471052; EAW79138.1; -; Genomic_DNA.
EMBL; CH471052; EAW79139.1; -; Genomic_DNA.
EMBL; CH471052; EAW79140.1; -; Genomic_DNA.
EMBL; CH471052; EAW79141.1; -; Genomic_DNA.
EMBL; BC014050; AAH14050.1; -; mRNA.
EMBL; BC068997; AAH68997.1; -; mRNA.
EMBL; BK005503; DAA05503.1; -; mRNA.
CCDS; CCDS3086.1; -. [Q96MT8-1]
CCDS; CCDS43152.1; -. [Q96MT8-4]
CCDS; CCDS43153.1; -. [Q96MT8-2]
CCDS; CCDS43154.1; -. [Q96MT8-3]
RefSeq; NP_001035842.1; NM_001042383.1. [Q96MT8-3]
RefSeq; NP_001035843.1; NM_001042384.1. [Q96MT8-4]
RefSeq; NP_001035859.1; NM_001042400.1. [Q96MT8-2]
RefSeq; NP_079456.2; NM_025180.3. [Q96MT8-1]
RefSeq; XP_005247854.1; XM_005247797.3. [Q96MT8-1]
RefSeq; XP_006713823.1; XM_006713760.3. [Q96MT8-1]
RefSeq; XP_011511496.1; XM_011513194.2.
RefSeq; XP_016862743.1; XM_017007254.1.
RefSeq; XP_016862744.1; XM_017007255.1.
RefSeq; XP_016862745.1; XM_017007256.1.
RefSeq; XP_016862751.1; XM_017007262.1.
RefSeq; XP_016862752.1; XM_017007263.1.
RefSeq; XP_016862753.1; XM_017007264.1.
RefSeq; XP_016862755.1; XM_017007266.1.
RefSeq; XP_016862756.1; XM_017007267.1.
UniGene; Hs.443301; -.
ProteinModelPortal; Q96MT8; -.
SMR; Q96MT8; -.
BioGrid; 123200; 122.
DIP; DIP-36374N; -.
IntAct; Q96MT8; 132.
MINT; Q96MT8; -.
STRING; 9606.ENSP00000336524; -.
iPTMnet; Q96MT8; -.
PhosphoSitePlus; Q96MT8; -.
BioMuta; CEP63; -.
DMDM; 56748851; -.
EPD; Q96MT8; -.
MaxQB; Q96MT8; -.
PaxDb; Q96MT8; -.
PeptideAtlas; Q96MT8; -.
PRIDE; Q96MT8; -.
ProteomicsDB; 77406; -.
ProteomicsDB; 77407; -. [Q96MT8-2]
ProteomicsDB; 77408; -. [Q96MT8-3]
ProteomicsDB; 77409; -. [Q96MT8-4]
DNASU; 80254; -.
Ensembl; ENST00000332047; ENSP00000328382; ENSG00000182923. [Q96MT8-3]
Ensembl; ENST00000337090; ENSP00000336524; ENSG00000182923. [Q96MT8-1]
Ensembl; ENST00000354446; ENSP00000346432; ENSG00000182923. [Q96MT8-4]
Ensembl; ENST00000383229; ENSP00000372716; ENSG00000182923. [Q96MT8-2]
Ensembl; ENST00000513612; ENSP00000426129; ENSG00000182923. [Q96MT8-1]
Ensembl; ENST00000606977; ENSP00000475903; ENSG00000182923. [Q96MT8-1]
Ensembl; ENST00000620544; ENSP00000482219; ENSG00000182923. [Q96MT8-4]
GeneID; 80254; -.
KEGG; hsa:80254; -.
UCSC; uc003eql.2; human. [Q96MT8-1]
CTD; 80254; -.
DisGeNET; 80254; -.
EuPathDB; HostDB:ENSG00000182923.16; -.
GeneCards; CEP63; -.
GeneReviews; CEP63; -.
HGNC; HGNC:25815; CEP63.
HPA; HPA058154; -.
HPA; HPA058313; -.
MalaCards; CEP63; -.
MIM; 614724; gene.
MIM; 614728; phenotype.
neXtProt; NX_Q96MT8; -.
OpenTargets; ENSG00000182923; -.
Orphanet; 2512; Autosomal recessive primary microcephaly.
PharmGKB; PA142672124; -.
eggNOG; ENOG410IFN5; Eukaryota.
eggNOG; ENOG4111HAY; LUCA.
GeneTree; ENSGT00530000063797; -.
InParanoid; Q96MT8; -.
KO; K16763; -.
OMA; QKSLDWE; -.
OrthoDB; EOG091G0LBG; -.
PhylomeDB; Q96MT8; -.
TreeFam; TF330595; -.
Reactome; R-HSA-2565942; Regulation of PLK1 Activity at G2/M Transition.
Reactome; R-HSA-380259; Loss of Nlp from mitotic centrosomes.
Reactome; R-HSA-380270; Recruitment of mitotic centrosome proteins and complexes.
Reactome; R-HSA-380284; Loss of proteins required for interphase microtubule organization from the centrosome.
Reactome; R-HSA-380320; Recruitment of NuMA to mitotic centrosomes.
Reactome; R-HSA-5620912; Anchoring of the basal body to the plasma membrane.
Reactome; R-HSA-8854518; AURKA Activation by TPX2.
ChiTaRS; CEP63; human.
GeneWiki; CEP63; -.
GenomeRNAi; 80254; -.
PRO; PR:Q96MT8; -.
Proteomes; UP000005640; Chromosome 3.
Bgee; ENSG00000182923; Expressed in 225 organ(s), highest expression level in testis.
CleanEx; HS_CEP63; -.
ExpressionAtlas; Q96MT8; baseline and differential.
Genevisible; Q96MT8; HS.
GO; GO:0005814; C:centriole; ISS:UniProtKB.
GO; GO:0005813; C:centrosome; IDA:UniProtKB.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0000922; C:spindle pole; ISS:UniProtKB.
GO; GO:0051301; P:cell division; IEA:UniProtKB-KW.
GO; GO:0007099; P:centriole replication; IMP:UniProtKB.
GO; GO:0097711; P:ciliary basal body-plasma membrane docking; TAS:Reactome.
GO; GO:0098535; P:de novo centriole assembly involved in multi-ciliated epithelial cell differentiation; IBA:GO_Central.
GO; GO:0000077; P:DNA damage checkpoint; ISS:UniProtKB.
GO; GO:0000086; P:G2/M transition of mitotic cell cycle; TAS:Reactome.
GO; GO:0010389; P:regulation of G2/M transition of mitotic cell cycle; TAS:Reactome.
GO; GO:0042770; P:signal transduction in response to DNA damage; ISS:UniProtKB.
GO; GO:0051225; P:spindle assembly; ISS:UniProtKB.
InterPro; IPR029608; Cep63.
InterPro; IPR031470; Cep63/Deup1_N.
PANTHER; PTHR18875:SF7; PTHR18875:SF7; 1.
Pfam; PF17045; CEP63; 1.
1: Evidence at protein level;
Acetylation; Alternative splicing; Cell cycle; Cell division;
Coiled coil; Complete proteome; Cytoplasm; Cytoskeleton; DNA damage;
Dwarfism; Mental retardation; Mitosis; Phosphoprotein; Polymorphism;
Reference proteome.
CHAIN 1 703 Centrosomal protein of 63 kDa.
/FTId=PRO_0000089493.
COILED 22 199 {ECO:0000255}.
COILED 242 306 {ECO:0000255}.
COILED 353 533 {ECO:0000255}.
COILED 676 703 {ECO:0000255}.
MOD_RES 1 1 N-acetylmethionine.
{ECO:0000244|PubMed:22814378}.
MOD_RES 278 278 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
VAR_SEQ 310 355 Missing (in isoform 3 and isoform 4).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_012251.
VAR_SEQ 490 651 Missing (in isoform 2 and isoform 3).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_012252.
VAR_SEQ 490 521 AKEISLADLQENYIEALNKLVSENQQLQKDLM -> RWGFT
MLSSLVLNFGIQAIRQPQRPKVLELQV (in isoform
4). {ECO:0000303|PubMed:14702039}.
/FTId=VSP_012253.
VAR_SEQ 522 703 Missing (in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_012254.
VARIANT 651 651 S -> L (in dbSNP:rs1127826).
/FTId=VAR_020604.
CONFLICT 365 365 K -> R (in Ref. 1; BAB14662).
{ECO:0000305}.
SEQUENCE 703 AA; 81344 MW; D5406B75BB19B5D0 CRC64;
MEALLEGIQN RGHGGGFLTS CEAELQELMK QIDIMVAHKK SEWEGRTHAL ETCLKIREQE
LKSLRSQLDV THKEVGMLHQ QVEEHEKIKQ EMTMEYKQEL KKLHEELCIL KRSYEKLQKK
QMREFRGNTK NHREDRSEIE RLTAKIEEFR QKSLDWEKQR LIYQQQVSSL EAQRKALAEQ
SEIIQAQLVN RKQKLESVEL SSQSEIQHLS SKLERANDTI CANELEIERL TMRVNDLVGT
SMTVLQEQQQ KEEKLRESEK LLEALQEEKR ELKAALQSQE NLIHEARIQK EKLQEKVKAT
NTQHAVEAIR PREESLAEKK YTSQGQGDLD SVLSQLNFTH TSEDLLQAEV TCLEGSLESV
SATCKQLSQE LMEKYEELKR MEAHNNEYKA EIKKLKEQIL QGEQSYSSAL EGMKMEISHL
TQELHQRDIT IASTKGSSSD MEKRLRAEMQ KAEDKAVEHK EILDQLESLK LENRHLSEMV
MKLELGLHEA KEISLADLQE NYIEALNKLV SENQQLQKDL MNTKSQLEIS TQMCKKQNDR
IFKPTHSRTT EFKNTEFKPT HGQHRHDGIK TEHYKTDLHS PRGQASDSIN PMSRVLSPLS
PQISPCSSTR SLTSYSLCKT HSLPSALDTN EANFSDTMSE SMNDQEEFIS SCSLPVSPLG
SIATRFLEEE ELRSHHILER LDAHIEELKR ESEKTVRQFT ALK


Related products :

Catalog number Product name Quantity
EIAAB06849 Centrosomal protein of 63 kDa,Cep63,CEP63,Homo sapiens,Human
EIAAB06848 Centrosomal protein of 63 kDa,Cep63,Cep63,D9Mgc48e,Mouse,Mus musculus
EIAAB06847 Centrosomal protein of 63 kDa,Cep63,Cep63,Rat,Rattus norvegicus
EIAAB06850 Centrosomal protein of 63 kDa,Cep63,CEP63,Chicken,Gallus gallus
CSB-EL005245RA Rat Centrosomal protein of 63 kDa(CEP63) ELISA kit 96T
CSB-EL005245HU Human Centrosomal protein of 63 kDa(CEP63) ELISA kit 96T
CSB-EL005245RA Rat Centrosomal protein of 63 kDa(CEP63) ELISA kit SpeciesRat 96T
CSB-EL005245CH Chicken Centrosomal protein of 63 kDa(CEP63) ELISA kit 96T
201-20-1022 CEP63{centrosomal protein 63kDa}rabbit.pAb 0.1ml
CSB-EL005245MO Mouse Centrosomal protein of 63 kDa(CEP63) ELISA kit 96T
CEP63 CEP55 Gene centrosomal protein 55kDa
CEP70 CEP63 Gene centrosomal protein 63kDa
CSB-EL005245MO Mouse Centrosomal protein of 63 kDa(CEP63) ELISA kit SpeciesMouse 96T
CSB-EL005245CH Chicken Centrosomal protein of 63 kDa(CEP63) ELISA kit SpeciesChicken 96T
CSB-EL005245HU Human Centrosomal protein of 63 kDa(CEP63) ELISA kit SpeciesHuman 96T
CEP63_HUMAN ELISA Kit FOR Centrosomal protein of 63 kDa; organism: Human; gene name: CEP63 96T
CEP63_MOUSE ELISA Kit FOR Centrosomal protein of 63 kDa; organism: Mouse; gene name: Cep63 96T
CSB-EL005245RA Rat centrosomal protein 63kDa (CEP63) ELISA kit, Species Rat, Sample Type serum, plasma 96T
CSB-EL005245MO Mouse centrosomal protein 63kDa (CEP63) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL005245HU Human centrosomal protein 63kDa (CEP63) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL005245CH Chicken centrosomal protein 63kDa (CEP63) ELISA kit, Species Chicken, Sample Type serum, plasma 96T
EIAAB08871 250 kDa centrosomal protein,Centrosomal Nek2-associated protein 1,Centrosomal protein 2,Centrosome-associated protein CEP250,Cep2,Cep250,Cep250,C-Nap1,Inmp,Intranuclear matrix protein,Mouse,Mus muscul
EIAAB08872 250 kDa centrosomal protein,Centrosomal Nek2-associated protein 1,Centrosomal protein 2,Centrosome-associated protein CEP250,CEP2,Cep250,CEP250,CNAP1,C-Nap1,Homo sapiens,Human
EIAAB06679 C6orf182,Centrosomal protein 57kDa-like protein 1,Centrosomal protein CEP57L1,Centrosomal protein of 57 kDa-related protein,CEP57L1,Cep57R,CEP57R,Cep57-related protein,Homo sapiens,Human
EIAAB06681 Centrosomal protein 57kDa-like protein 1,Centrosomal protein CEP57L1,Centrosomal protein of 57 kDa-related protein,Cep57l1,Cep57R,Cep57r,Cep57-related protein,Rat,Rattus norvegicus


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur