Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Centrosomal protein of 76 kDa (Cep76)

 CEP76_HUMAN             Reviewed;         659 AA.
Q8TAP6; B0YJB2; B4DXG5; B4DZW1; Q658N5; Q9H9U7;
15-FEB-2005, integrated into UniProtKB/Swiss-Prot.
01-JUN-2002, sequence version 1.
12-SEP-2018, entry version 134.
RecName: Full=Centrosomal protein of 76 kDa;
Short=Cep76;
Name=CEP76; Synonyms=C18orf9;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
TISSUE=Teratocarcinoma, Testis, and Thymus;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
NHLBI resequencing and genotyping service (RS&G);
Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16177791; DOI=10.1038/nature03983;
Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D.,
Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K.,
FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S.,
Bloom T., Bugalter B., Butler J., Cook A., DeCaprio D., Engels R.,
Garber M., Gnirke A., Hafez N., Hall J.L., Norman C.H., Itoh T.,
Jaffe D.B., Kuroki Y., Lehoczky J., Lui A., Macdonald P., Mauceli E.,
Mikkelsen T.S., Naylor J.W., Nicol R., Nguyen C., Noguchi H.,
O'Leary S.B., Piqani B., Smith C.L., Talamas J.A., Topham K.,
Totoki Y., Toyoda A., Wain H.M., Young S.K., Zeng Q., Zimmer A.R.,
Fujiyama A., Hattori M., Birren B.W., Sakaki Y., Lander E.S.;
"DNA sequence and analysis of human chromosome 18.";
Nature 437:551-555(2005).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-73.
TISSUE=Stomach;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[7]
SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS].
TISSUE=Lymphoblast;
PubMed=14654843; DOI=10.1038/nature02166;
Andersen J.S., Wilkinson C.J., Mayor T., Mortensen P., Nigg E.A.,
Mann M.;
"Proteomic characterization of the human centrosome by protein
correlation profiling.";
Nature 426:570-574(2003).
[8]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18691976; DOI=10.1016/j.molcel.2008.07.007;
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,
Greff Z., Keri G., Stemmann O., Mann M.;
"Kinase-selective enrichment enables quantitative phosphoproteomics of
the kinome across the cell cycle.";
Mol. Cell 31:438-448(2008).
[9]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-83, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[10]
FUNCTION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, AND INTERACTION
WITH CCP110 AND CEP97.
PubMed=19460342; DOI=10.1016/j.devcel.2009.03.004;
Tsang W.Y., Spektor A., Vijayakumar S., Bista B.R., Li J., Sanchez I.,
Duensing S., Dynlacht B.D.;
"Cep76, a centrosomal protein that specifically restrains centriole
reduplication.";
Dev. Cell 16:649-660(2009).
[11]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-83, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
-!- FUNCTION: Centrosomal protein involved in regulation of centriole
duplication. Required to limit centriole duplication to once per
cell cycle by preventing centriole reduplication.
{ECO:0000269|PubMed:19460342}.
-!- SUBUNIT: Interacts with CCP110 and CEP97.
{ECO:0000269|PubMed:19460342}.
-!- INTERACTION:
O43687-2:AKAP7; NbExp=5; IntAct=EBI-742887, EBI-10185182;
A0A0S2Z5G4:BANP; NbExp=3; IntAct=EBI-742887, EBI-16429704;
B4DE54:BANP; NbExp=3; IntAct=EBI-742887, EBI-16429313;
Q8N9N5:BANP; NbExp=3; IntAct=EBI-742887, EBI-744695;
Q8N9N5-7:BANP; NbExp=3; IntAct=EBI-742887, EBI-16429296;
Q6P5X5:C22orf39; NbExp=5; IntAct=EBI-742887, EBI-7317823;
Q9NP86:CABP5; NbExp=5; IntAct=EBI-742887, EBI-10311131;
A0A0S2Z3E6:CAPN3; NbExp=3; IntAct=EBI-742887, EBI-16430532;
Q53HC0:CCDC92; NbExp=3; IntAct=EBI-742887, EBI-719994;
Q86X95:CIR1; NbExp=3; IntAct=EBI-742887, EBI-627102;
P53673:CRYBA4; NbExp=8; IntAct=EBI-742887, EBI-7519711;
Q9HCP0:CSNK1G1; NbExp=3; IntAct=EBI-742887, EBI-1383814;
Q9NTM9:CUTC; NbExp=3; IntAct=EBI-742887, EBI-714918;
Q8IYY4:DZIP1L; NbExp=3; IntAct=EBI-742887, EBI-10264440;
Q96JC9:EAF1; NbExp=3; IntAct=EBI-742887, EBI-769261;
Q86YD7:FAM90A1; NbExp=5; IntAct=EBI-742887, EBI-6658203;
Q9NXN4:GDAP2; NbExp=3; IntAct=EBI-742887, EBI-10316460;
Q9UBY9:HSPB7; NbExp=5; IntAct=EBI-742887, EBI-739361;
A1L0T0:ILVBL; NbExp=3; IntAct=EBI-742887, EBI-720553;
Q96AT1:KIAA1143; NbExp=6; IntAct=EBI-742887, EBI-2548425;
Q8TBB5:KLHDC4; NbExp=3; IntAct=EBI-742887, EBI-8472352;
Q6PJG3:LATS1; NbExp=3; IntAct=EBI-742887, EBI-10253976;
O95983:MBD3; NbExp=3; IntAct=EBI-742887, EBI-1783068;
Q8NBF2:NHLRC2; NbExp=3; IntAct=EBI-742887, EBI-10269163;
A0A0S2Z4M0:NME5; NbExp=4; IntAct=EBI-742887, EBI-16430544;
Q9BYG5:PARD6B; NbExp=5; IntAct=EBI-742887, EBI-295391;
Q13526:PIN1; NbExp=5; IntAct=EBI-742887, EBI-714158;
Q9NQ66:PLCB1; NbExp=3; IntAct=EBI-742887, EBI-3396023;
Q96HA1:POM121; NbExp=3; IntAct=EBI-742887, EBI-739990;
Q96JH8:RADIL; NbExp=3; IntAct=EBI-742887, EBI-744267;
Q8TEB7:RNF128; NbExp=5; IntAct=EBI-742887, EBI-2341619;
P32969:RPL9P9; NbExp=5; IntAct=EBI-742887, EBI-358122;
Q9Y467:SALL2; NbExp=4; IntAct=EBI-742887, EBI-746180;
Q9H788:SH2D4A; NbExp=3; IntAct=EBI-742887, EBI-747035;
P10827:THRA; NbExp=3; IntAct=EBI-742887, EBI-286285;
Q14106:TOB2; NbExp=3; IntAct=EBI-742887, EBI-2562000;
Q9Y5U2:TSSC4; NbExp=3; IntAct=EBI-742887, EBI-717229;
A0A0B4J1Y2:TTC21A; NbExp=5; IntAct=EBI-742887, EBI-10220701;
Q9NNX1:TUFT1; NbExp=3; IntAct=EBI-742887, EBI-2557363;
O14530:TXNDC9; NbExp=3; IntAct=EBI-742887, EBI-707554;
Q8IZQ1-2:WDFY3; NbExp=3; IntAct=EBI-742887, EBI-10264625;
O43167:ZBTB24; NbExp=5; IntAct=EBI-742887, EBI-744471;
Q96NC0:ZMAT2; NbExp=3; IntAct=EBI-742887, EBI-2682299;
Q03923-3:ZNF85; NbExp=3; IntAct=EBI-742887, EBI-10223330;
-!- SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton, microtubule
organizing center, centrosome. Cytoplasm, cytoskeleton,
microtubule organizing center, centrosome, centriole. Note=Does
not localize along the ciliary axoneme.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q8TAP6-1; Sequence=Displayed;
Name=2;
IsoId=Q8TAP6-2; Sequence=VSP_037611;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q8TAP6-3; Sequence=VSP_037610, VSP_037612, VSP_037613;
Note=No experimental confirmation available.;
-!- DEVELOPMENTAL STAGE: Expressed at low level in G1 and is induced
in S and G2 phase, during which point centrioles have already
commenced duplication (at protein level).
{ECO:0000269|PubMed:19460342}.
-!- SIMILARITY: Belongs to the CEP76 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAG64223.1; Type=Erroneous termination; Positions=648; Note=Translated as Trp.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AK022604; BAB14123.1; -; mRNA.
EMBL; AK301964; BAG63377.1; -; mRNA.
EMBL; AK303117; BAG64223.1; ALT_SEQ; mRNA.
EMBL; EF445040; ACA06091.1; -; Genomic_DNA.
EMBL; AP005482; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471113; EAX01543.1; -; Genomic_DNA.
EMBL; BC026307; AAH26307.1; -; mRNA.
EMBL; AL833727; CAH56252.1; -; mRNA.
CCDS; CCDS11861.1; -. [Q8TAP6-1]
CCDS; CCDS62390.1; -. [Q8TAP6-2]
RefSeq; NP_001258918.1; NM_001271989.1. [Q8TAP6-2]
RefSeq; NP_079175.2; NM_024899.3. [Q8TAP6-1]
UniGene; Hs.236940; -.
ProteinModelPortal; Q8TAP6; -.
SMR; Q8TAP6; -.
BioGrid; 123028; 174.
IntAct; Q8TAP6; 112.
MINT; Q8TAP6; -.
STRING; 9606.ENSP00000262127; -.
iPTMnet; Q8TAP6; -.
PhosphoSitePlus; Q8TAP6; -.
DMDM; 59797956; -.
EPD; Q8TAP6; -.
MaxQB; Q8TAP6; -.
PaxDb; Q8TAP6; -.
PeptideAtlas; Q8TAP6; -.
PRIDE; Q8TAP6; -.
ProteomicsDB; 73901; -.
ProteomicsDB; 73902; -. [Q8TAP6-2]
ProteomicsDB; 73903; -. [Q8TAP6-3]
Ensembl; ENST00000262127; ENSP00000262127; ENSG00000101624. [Q8TAP6-1]
Ensembl; ENST00000423709; ENSP00000403074; ENSG00000101624. [Q8TAP6-2]
GeneID; 79959; -.
KEGG; hsa:79959; -.
UCSC; uc002kri.5; human. [Q8TAP6-1]
CTD; 79959; -.
EuPathDB; HostDB:ENSG00000101624.10; -.
GeneCards; CEP76; -.
HGNC; HGNC:25727; CEP76.
HPA; HPA039395; -.
neXtProt; NX_Q8TAP6; -.
OpenTargets; ENSG00000101624; -.
PharmGKB; PA134916911; -.
eggNOG; ENOG410IFDB; Eukaryota.
eggNOG; ENOG410XWNZ; LUCA.
GeneTree; ENSGT00390000000781; -.
HOGENOM; HOG000008143; -.
HOVERGEN; HBG050901; -.
InParanoid; Q8TAP6; -.
KO; K16457; -.
OMA; LAPDQQH; -.
OrthoDB; EOG091G02SF; -.
PhylomeDB; Q8TAP6; -.
TreeFam; TF329324; -.
Reactome; R-HSA-2565942; Regulation of PLK1 Activity at G2/M Transition.
Reactome; R-HSA-380259; Loss of Nlp from mitotic centrosomes.
Reactome; R-HSA-380270; Recruitment of mitotic centrosome proteins and complexes.
Reactome; R-HSA-380284; Loss of proteins required for interphase microtubule organization from the centrosome.
Reactome; R-HSA-380320; Recruitment of NuMA to mitotic centrosomes.
Reactome; R-HSA-5620912; Anchoring of the basal body to the plasma membrane.
Reactome; R-HSA-8854518; AURKA Activation by TPX2.
GeneWiki; CEP76; -.
GenomeRNAi; 79959; -.
PRO; PR:Q8TAP6; -.
Proteomes; UP000005640; Chromosome 18.
Bgee; ENSG00000101624; Expressed in 183 organ(s), highest expression level in secondary oocyte.
CleanEx; HS_CEP76; -.
ExpressionAtlas; Q8TAP6; baseline and differential.
Genevisible; Q8TAP6; HS.
GO; GO:0005814; C:centriole; IDA:UniProtKB.
GO; GO:0005813; C:centrosome; IDA:UniProtKB.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0032991; C:protein-containing complex; IDA:MGI.
GO; GO:0097711; P:ciliary basal body-plasma membrane docking; TAS:Reactome.
GO; GO:0000086; P:G2/M transition of mitotic cell cycle; TAS:Reactome.
GO; GO:0046599; P:regulation of centriole replication; IMP:UniProtKB.
GO; GO:0010389; P:regulation of G2/M transition of mitotic cell cycle; TAS:Reactome.
InterPro; IPR028926; CEP76-C2.
InterPro; IPR038765; Papain_like_cys_pep_sf.
Pfam; PF15627; CEP76-C2; 1.
SUPFAM; SSF54001; SSF54001; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm; Cytoskeleton;
Phosphoprotein; Reference proteome.
CHAIN 1 659 Centrosomal protein of 76 kDa.
/FTId=PRO_0000089501.
MOD_RES 75 75 Phosphoserine.
{ECO:0000250|UniProtKB:Q0VEJ0}.
MOD_RES 83 83 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:19690332}.
VAR_SEQ 1 178 Missing (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_037610.
VAR_SEQ 99 174 TNIDPTRRYLYLQVLGGKAFLEHLQEPEPLPGQVCSTFTLC
LHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLG -> S
(in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_037611.
VAR_SEQ 431 445 YIHKPTNPDEPPVAE -> LCFQPSDVPGKLSTL (in
isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_037612.
VAR_SEQ 446 659 Missing (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_037613.
CONFLICT 314 314 N -> S (in Ref. 1; BAB14123).
{ECO:0000305}.
CONFLICT 606 606 R -> G (in Ref. 1; BAB14123).
{ECO:0000305}.
SEQUENCE 659 AA; 74413 MW; 66EB85DCDCBEE518 CRC64;
MSLPPEKASE LKQLIHQQLS KMDVHGRIRE ILAETIREEL APDQQHLSTE DLIKALRRRG
IIDDVMKELN FVTDSVEQEL PSSPKQPICF DRQSTLKKTN IDPTRRYLYL QVLGGKAFLE
HLQEPEPLPG QVCSTFTLCL HYRNQRFRSK PVPCACEPDF HDGFLLEVHR ESLGDGTRMA
DSTTMLSISD PIHMVLIKTD IFGETTLVAS YFLEWRSVLG SENGVTSLTV ELMGVGTESK
VSVGILNIKL EMYPPLNQTL SQEVVNTQLA LERQKTAEKE RLFLVYAKQW WREYLQIRPS
HNSRLVKIFA QDENGINRPV CSYVKPLRAG RLLDTPRQAA RFVNVLGYER APVIGGGGKQ
EQWCTLLAFL CRNKGDCEDH ANLLCSLLLG YGLEAFVCVG TKAKGVPHAW VMTCGTDGAI
TFWESLTGHR YIHKPTNPDE PPVAEQPKPL YPYRTIGCVF NHQMFLGNCQ PSDAVETCVF
DLNDESKWKP MSEEAIKSVC APGATTSLPP FPPLCASTID ASVTSNEIEM QLRLLVSEHR
KDLGLTTVWE DQLSYLLSPA LASYEFERTT SISAGNEEFQ DAIRRAVPDG HTFKGFPIHF
VYRNARRAFA TCLRSPFCEE IICCRGDQVR LAVRVRVFTY PESACAVWIM FACKYRSVL


Related products :

Catalog number Product name Quantity
EIAAB06858 C18orf9,Centrosomal protein of 76 kDa,Cep76,CEP76,Homo sapiens,Human
EIAAB06857 Centrosomal protein of 76 kDa,Cep76,Cep76,Mouse,Mus musculus
CEP76 CEP70 Gene centrosomal protein 70kDa
CSB-EL005249MO Mouse Centrosomal protein of 76 kDa(CEP76) ELISA kit 96T
CSB-EL005249HU Human Centrosomal protein of 76 kDa(CEP76) ELISA kit 96T
CEP97 CEP76 Gene centrosomal protein 76kDa
CSB-EL005249HU Human Centrosomal protein of 76 kDa(CEP76) ELISA kit SpeciesHuman 96T
CSB-EL005249MO Mouse Centrosomal protein of 76 kDa(CEP76) ELISA kit SpeciesMouse 96T
CEP76_MOUSE ELISA Kit FOR Centrosomal protein of 76 kDa; organism: Mouse; gene name: Cep76 96T
CEP76_HUMAN ELISA Kit FOR Centrosomal protein of 76 kDa; organism: Human; gene name: CEP76 96T
CSB-EL005249HU Human centrosomal protein 76kDa (CEP76) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL005249MO Mouse centrosomal protein 76kDa (CEP76) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
EIAAB08871 250 kDa centrosomal protein,Centrosomal Nek2-associated protein 1,Centrosomal protein 2,Centrosome-associated protein CEP250,Cep2,Cep250,Cep250,C-Nap1,Inmp,Intranuclear matrix protein,Mouse,Mus muscul
EIAAB08872 250 kDa centrosomal protein,Centrosomal Nek2-associated protein 1,Centrosomal protein 2,Centrosome-associated protein CEP250,CEP2,Cep250,CEP250,CNAP1,C-Nap1,Homo sapiens,Human
EIAAB06679 C6orf182,Centrosomal protein 57kDa-like protein 1,Centrosomal protein CEP57L1,Centrosomal protein of 57 kDa-related protein,CEP57L1,Cep57R,CEP57R,Cep57-related protein,Homo sapiens,Human
EIAAB06681 Centrosomal protein 57kDa-like protein 1,Centrosomal protein CEP57L1,Centrosomal protein of 57 kDa-related protein,Cep57l1,Cep57R,Cep57r,Cep57-related protein,Rat,Rattus norvegicus
EIAAB06680 Centrosomal protein 57kDa-like protein 1,Centrosomal protein CEP57L1,Centrosomal protein of 57 kDa-related protein,Cep57l1,Cep57R,Cep57r,Cep57-related protein,Mouse,Mus musculus
EIAAB08340 Centriolin,Centrosomal protein 1,Centrosomal protein of 110 kDa,CEP1,Cep110,CEP110,CNTRL,Homo sapiens,Human
EIAAB08339 Centriolin,Centrosomal protein 1,Centrosomal protein of 110 kDa,Cep1,Cep110,Cep110,Cntrl,Mouse,Mus musculus
EIAAB08838 Centrosomal protein 4,Centrosomal protein of 135 kDa,Cep135,CEP135,CEP4,Homo sapiens,Human,KIAA0635
EIAAB08839 Centrosomal protein 4,Centrosomal protein of 135 kDa,Cep135,Cep135,Cep4,Kiaa0635,Mouse,Mus musculus
H00079959-P01-25 CEP76 (Human) Recombinant Protein (P01) 25 ug
EIAAB06777 CENPJ,CENP-J,Centromere protein J,Centrosomal P4.1-associated protein,CPAP,Homo sapiens,Human,LAG-3-associated protein,LAP,LIP1,LYST-interacting protein 1
5083 Centrosomal protein 164 0.5 mg
5083 Centrosomal protein 164 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur