Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Choline transporter-like protein 2 (Solute carrier family 44 member 2)

 CTL2_HUMAN              Reviewed;         706 AA.
Q8IWA5; B2RBB1; B3KNH3; B4DFJ0; F2Q9D7; Q658V1; Q658Z2; Q6PJV7;
Q8N2F0; Q9NY68;
30-AUG-2005, integrated into UniProtKB/Swiss-Prot.
02-NOV-2010, sequence version 3.
27-SEP-2017, entry version 130.
RecName: Full=Choline transporter-like protein 2;
AltName: Full=Solute carrier family 44 member 2;
Name=SLC44A2; Synonyms=CTL2; ORFNames=PSEC0210;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1),
FUNCTION, AND VARIANT ARG-154.
PubMed=10677542; DOI=10.1073/pnas.030339697;
O'Regan S., Traiffort E., Ruat M., Cha N., Compaore D., Meunier F.-M.;
"An electric lobe suppressor for a yeast choline transport mutation
belongs to a new family of transporter-like proteins.";
Proc. Natl. Acad. Sci. U.S.A. 97:1835-1840(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DISEASE, TISSUE SPECIFICITY,
AND VARIANT ARG-154.
TISSUE=Epithelium, and Inner ear;
PubMed=14973250; DOI=10.1523/JNEUROSCI.5063-03.2004;
Nair T.S., Kozma K.E., Hoefling N.L., Kommareddi P.K., Ueda Y.,
Gong T.-W., Lomax M.I., Lansford C.D., Telian S.A., Satar B.,
Arts H.A., El-Kashlan H.K., Berryhill W.E., Raphael Y., Carey T.E.;
"Identification and characterization of choline transporter-like
protein 2, an inner ear glycoprotein of 68 and 72 kDa that is the
target of antibody-induced hearing loss.";
J. Neurosci. 24:1772-1779(2004).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Santoso S.S., Bayat B.B., Sachs U.;
"Detection of HNA-3b antibodies in patient sera.";
Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 565-706 (ISOFORM 2), AND VARIANT
ARG-154.
TISSUE=Brain cortex, Placenta, and Teratocarcinoma;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND VARIANT ARG-154.
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
ARG-154.
TISSUE=Eye, and Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 60-706 (ISOFORM 1),
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 273-706 (ISOFORM 2), AND
VARIANT ARG-154.
TISSUE=Stomach;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 321-706 (ISOFORM 1).
TISSUE=Embryo;
PubMed=16303743; DOI=10.1093/dnares/12.2.117;
Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J.,
Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S.,
Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.,
Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S.,
Isogai T.;
"Signal sequence and keyword trap in silico for selection of full-
length human cDNAs encoding secretion or membrane proteins from oligo-
capped cDNA libraries.";
DNA Res. 12:117-126(2005).
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 663-706 (ISOFORM 3).
Yu W., Gibbs R.A.;
Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases.
[11]
INTERACTION WITH COCH.
PubMed=17926100; DOI=10.1007/s10162-007-0099-2;
Kommareddi P.K., Nair T.S., Raphael Y., Telian S.A., Kim A.H.,
Arts H.A., El-Kashlan H.K., Carey T.E.;
"Cochlin isoforms and their interaction with CTL2 (SLC44A2) in the
inner ear.";
J. Assoc. Res. Otolaryngol. 8:435-446(2007).
[12]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-187 AND ASN-200.
TISSUE=Liver;
PubMed=19159218; DOI=10.1021/pr8008012;
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
"Glycoproteomics analysis of human liver tissue by combination of
multiple enzyme digestion and hydrazide chemistry.";
J. Proteome Res. 8:651-661(2009).
[13]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-187 AND ASN-200.
TISSUE=Leukemic T-cell;
PubMed=19349973; DOI=10.1038/nbt.1532;
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M.,
Schiess R., Aebersold R., Watts J.D.;
"Mass-spectrometric identification and relative quantification of N-
linked cell surface glycoproteins.";
Nat. Biotechnol. 27:378-386(2009).
[14]
FUNCTION, ALTERNATIVE PROMOTER USAGE, AND TISSUE SPECIFICITY.
PubMed=20665236; DOI=10.1007/s10930-010-9268-y;
Kommareddi P.K., Nair T.S., Thang L.V., Galano M.M., Babu E.,
Ganapathy V., Kanazawa T., McHugh J.B., Carey T.E.;
"Isoforms, expression, glycosylation, and tissue distribution of
CTL2/SLC44A2.";
Protein J. 29:417-426(2010).
[15]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-14, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[16]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25944712; DOI=10.1002/pmic.201400617;
Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M.,
Ayoub D., Lane L., Bairoch A., Van Dorsselaer A., Carapito C.;
"N-terminome analysis of the human mitochondrial proteome.";
Proteomics 15:2519-2524(2015).
-!- FUNCTION: Isoform 1, but not isoform 3, exhibits some choline
transporter activity. {ECO:0000269|PubMed:10677542,
ECO:0000269|PubMed:20665236}.
-!- SUBUNIT: Interacts with COCH. {ECO:0000269|PubMed:17926100}.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000250}; Multi-pass membrane
protein {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative promoter usage, Alternative splicing; Named isoforms=3;
Name=1; Synonyms=CTL2a, CTL2P2A;
IsoId=Q8IWA5-1; Sequence=Displayed;
Name=2; Synonyms=CTL2b, CTL2P2B;
IsoId=Q8IWA5-2; Sequence=VSP_015431;
Name=3; Synonyms=CTL2P1;
IsoId=Q8IWA5-3; Sequence=VSP_041792;
Note=Produced by alternative promoter usage.;
-!- TISSUE SPECIFICITY: Present in supporting cells of the inner ear
(at protein level). Only isoform 3 is expressed in inner ear
vestibular tissue. {ECO:0000269|PubMed:14973250,
ECO:0000269|PubMed:20665236}.
-!- SIMILARITY: Belongs to the CTL (choline transporter-like) family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAC11662.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AJ245621; CAB75542.1; -; Genomic_DNA.
EMBL; FN668568; CBJ93592.1; -; mRNA.
EMBL; AK027519; BAG51335.1; -; mRNA.
EMBL; AK294118; BAG57451.1; -; mRNA.
EMBL; AK314582; BAG37158.1; -; mRNA.
EMBL; AC011475; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471106; EAW84126.1; -; Genomic_DNA.
EMBL; BC010617; AAH10617.1; -; mRNA.
EMBL; BC040556; AAH40556.1; -; mRNA.
EMBL; AL832517; CAH56352.1; -; mRNA.
EMBL; AL832978; CAH56342.1; -; mRNA.
EMBL; AK075512; BAC11662.1; ALT_INIT; mRNA.
EMBL; AF070636; -; NOT_ANNOTATED_CDS; mRNA.
CCDS; CCDS12245.1; -. [Q8IWA5-1]
CCDS; CCDS54216.1; -. [Q8IWA5-3]
RefSeq; NP_001138528.1; NM_001145056.1. [Q8IWA5-3]
RefSeq; NP_065161.3; NM_020428.3. [Q8IWA5-1]
RefSeq; XP_005260054.1; XM_005259997.1. [Q8IWA5-2]
UniGene; Hs.534560; -.
ProteinModelPortal; Q8IWA5; -.
SMR; Q8IWA5; -.
BioGrid; 121410; 1.
IntAct; Q8IWA5; 1.
MINT; MINT-5006445; -.
STRING; 9606.ENSP00000336888; -.
DrugBank; DB00122; Choline.
TCDB; 2.A.92.1.4; the choline transporter-like (ctl) family.
iPTMnet; Q8IWA5; -.
PhosphoSitePlus; Q8IWA5; -.
SwissPalm; Q8IWA5; -.
BioMuta; SLC44A2; -.
DMDM; 311033462; -.
MaxQB; Q8IWA5; -.
PaxDb; Q8IWA5; -.
PeptideAtlas; Q8IWA5; -.
PRIDE; Q8IWA5; -.
Ensembl; ENST00000335757; ENSP00000336888; ENSG00000129353. [Q8IWA5-1]
Ensembl; ENST00000407327; ENSP00000385135; ENSG00000129353. [Q8IWA5-3]
Ensembl; ENST00000586078; ENSP00000466664; ENSG00000129353. [Q8IWA5-2]
GeneID; 57153; -.
KEGG; hsa:57153; -.
UCSC; uc002mpe.5; human. [Q8IWA5-1]
CTD; 57153; -.
DisGeNET; 57153; -.
EuPathDB; HostDB:ENSG00000129353.14; -.
GeneCards; SLC44A2; -.
H-InvDB; HIX0202740; -.
HGNC; HGNC:17292; SLC44A2.
HPA; HPA003228; -.
HPA; HPA070799; -.
MIM; 606106; gene.
neXtProt; NX_Q8IWA5; -.
OpenTargets; ENSG00000129353; -.
PharmGKB; PA142670899; -.
eggNOG; KOG1362; Eukaryota.
eggNOG; ENOG410XS0P; LUCA.
GeneTree; ENSGT00550000074521; -.
HOVERGEN; HBG062155; -.
InParanoid; Q8IWA5; -.
KO; K15377; -.
OMA; QTWMAFM; -.
OrthoDB; EOG091G04CQ; -.
PhylomeDB; Q8IWA5; -.
TreeFam; TF313325; -.
Reactome; R-HSA-1483191; Synthesis of PC.
Reactome; R-HSA-425366; Transport of bile salts and organic acids, metal ions and amine compounds.
Reactome; R-HSA-6798695; Neutrophil degranulation.
ChiTaRS; SLC44A2; human.
GeneWiki; SLC44A2; -.
GenomeRNAi; 57153; -.
PRO; PR:Q8IWA5; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000129353; -.
CleanEx; HS_SLC44A2; -.
ExpressionAtlas; Q8IWA5; baseline and differential.
Genevisible; Q8IWA5; HS.
GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB.
GO; GO:0016021; C:integral component of membrane; TAS:UniProtKB.
GO; GO:0005765; C:lysosomal membrane; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0035579; C:specific granule membrane; TAS:Reactome.
GO; GO:0015220; F:choline transmembrane transporter activity; TAS:UniProtKB.
GO; GO:0004871; F:signal transducer activity; IMP:UniProtKB.
GO; GO:0015871; P:choline transport; TAS:UniProtKB.
GO; GO:0043312; P:neutrophil degranulation; TAS:Reactome.
GO; GO:0006656; P:phosphatidylcholine biosynthetic process; TAS:Reactome.
GO; GO:0043123; P:positive regulation of I-kappaB kinase/NF-kappaB signaling; IMP:UniProtKB.
GO; GO:0055085; P:transmembrane transport; TAS:Reactome.
InterPro; IPR007603; Choline_transptr-like.
PANTHER; PTHR12385; PTHR12385; 1.
Pfam; PF04515; Choline_transpo; 1.
1: Evidence at protein level;
Alternative promoter usage; Alternative splicing; Complete proteome;
Glycoprotein; Membrane; Phosphoprotein; Polymorphism;
Reference proteome; Transmembrane; Transmembrane helix; Transport.
CHAIN 1 706 Choline transporter-like protein 2.
/FTId=PRO_0000191717.
TOPO_DOM 1 33 Cytoplasmic. {ECO:0000255}.
TRANSMEM 34 54 Helical. {ECO:0000255}.
TOPO_DOM 55 232 Extracellular. {ECO:0000255}.
TRANSMEM 233 253 Helical. {ECO:0000255}.
TOPO_DOM 254 256 Cytoplasmic. {ECO:0000255}.
TRANSMEM 257 277 Helical. {ECO:0000255}.
TOPO_DOM 278 315 Extracellular. {ECO:0000255}.
TRANSMEM 316 336 Helical. {ECO:0000255}.
TOPO_DOM 337 364 Cytoplasmic. {ECO:0000255}.
TRANSMEM 365 385 Helical. {ECO:0000255}.
TOPO_DOM 386 457 Extracellular. {ECO:0000255}.
TRANSMEM 458 480 Helical. {ECO:0000255}.
TOPO_DOM 481 504 Cytoplasmic. {ECO:0000255}.
TRANSMEM 505 525 Helical. {ECO:0000255}.
TOPO_DOM 526 563 Extracellular. {ECO:0000255}.
TRANSMEM 564 584 Helical. {ECO:0000255}.
TOPO_DOM 585 599 Cytoplasmic. {ECO:0000255}.
TRANSMEM 600 620 Helical. {ECO:0000255}.
TOPO_DOM 621 638 Extracellular. {ECO:0000255}.
TRANSMEM 639 659 Helical. {ECO:0000255}.
TOPO_DOM 660 706 Cytoplasmic. {ECO:0000255}.
MOD_RES 14 14 Phosphothreonine.
{ECO:0000244|PubMed:23186163}.
CARBOHYD 187 187 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:19159218,
ECO:0000269|PubMed:19349973}.
CARBOHYD 200 200 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:19159218,
ECO:0000269|PubMed:19349973}.
CARBOHYD 417 417 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 12 MGDERPHYYGKH -> MEDERKNGAY (in isoform
3). {ECO:0000303|PubMed:14702039,
ECO:0000303|Ref.10}.
/FTId=VSP_041792.
VAR_SEQ 672 706 LEDLERNDGSAERPYFMSSTLKKLLNKTNKKAAES -> CE
DLERNDGSQERPYFMSPELRDILLKGSAEEGKRAEAEE
(in isoform 2).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:17974005}.
/FTId=VSP_015431.
VARIANT 154 154 Q -> R (in dbSNP:rs2288904).
{ECO:0000269|PubMed:10677542,
ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:14973250,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:17974005,
ECO:0000269|Ref.6}.
/FTId=VAR_023404.
CONFLICT 92 92 I -> T (in Ref. 4; BAG51335).
{ECO:0000305}.
CONFLICT 153 153 L -> F (in Ref. 3; CBJ93592).
{ECO:0000305}.
CONFLICT 531 531 A -> G (in Ref. 1; CAB75542).
{ECO:0000305}.
CONFLICT 695 695 L -> P (in Ref. 7; AAH40556).
{ECO:0000305}.
SEQUENCE 706 AA; 80124 MW; 9A044A531930326E CRC64;
MGDERPHYYG KHGTPQKYDP TFKGPIYNRG CTDIICCVFL LLAIVGYVAV GIIAWTHGDP
RKVIYPTDSR GEFCGQKGTK NENKPYLFYF NIVKCASPLV LLEFQCPTPQ ICVEKCPDRY
LTYLNARSSR DFEYYKQFCV PGFKNNKGVA EVLQDGDCPA VLIPSKPLAR RCFPAIHAYK
GVLMVGNETT YEDGHGSRKN ITDLVEGAKK ANGVLEARQL AMRIFEDYTV SWYWIIIGLV
IAMAMSLLFI ILLRFLAGIM VWVMIIMVIL VLGYGIFHCY MEYSRLRGEA GSDVSLVDLG
FQTDFRVYLH LRQTWLAFMI ILSILEVIII LLLIFLRKRI LIAIALIKEA SRAVGYVMCS
LLYPLVTFFL LCLCIAYWAS TAVFLSTSNE AVYKIFDDSP CPFTAKTCNP ETFPSSNESR
QCPNARCQFA FYGGESGYHR ALLGLQIFNA FMFFWLANFV LALGQVTLAG AFASYYWALR
KPDDLPAFPL FSAFGRALRY HTGSLAFGAL ILAIVQIIRV ILEYLDQRLK AAENKFAKCL
MTCLKCCFWC LEKFIKFLNR NAYIMIAIYG TNFCTSARNA FFLLMRNIIR VAVLDKVTDF
LFLLGKLLIV GSVGILAFFF FTHRIRIVQD TAPPLNYYWV PILTVIVGSY LIAHGFFSVY
GMCVDTLFLC FLEDLERNDG SAERPYFMSS TLKKLLNKTN KKAAES


Related products :

Catalog number Product name Quantity
EIAAB37434 CHT,Cht1,Hemicholinium-3-sensitive choline transporter,High affinity choline transporter 1,Rat,Rattus norvegicus,Slc5a7,Solute carrier family 5 member 7
EIAAB37433 CHT,Cht1,Hemicholinium-3-sensitive choline transporter,High affinity choline transporter 1,Mouse,Mus musculus,Slc5a7,Solute carrier family 5 member 7
EIAAB37432 CHT,CHT1,Hemicholinium-3-sensitive choline transporter,High affinity choline transporter 1,Homo sapiens,Human,SLC5A7,Solute carrier family 5 member 7
EIAAB09828 Choline transporter-like protein 2,CTL2,Pig,SLC44A2,Solute carrier family 44 member 2,Sus scrofa
EIAAB09837 Choline transporter-like protein 4,CTL4,Pig,SLC44A4,Solute carrier family 44 member 4,Sus scrofa
EIAAB09833 Choline transporter-like protein 3,Ctl3,Mouse,Mus musculus,Slc44a3,Solute carrier family 44 member 3
EIAAB09838 Bos taurus,Bovine,Choline transporter-like protein 4,CTL4,SLC44A4,Solute carrier family 44 member 4
EIAAB09832 Choline transporter-like protein 3,Ctl3,Rat,Rattus norvegicus,Slc44a3,Solute carrier family 44 member 3
EIAAB09829 Choline transporter-like protein 2,Ctl2,Rat,Rattus norvegicus,Slc44a2,Solute carrier family 44 member 2
EIAAB09834 Bos taurus,Bovine,Choline transporter-like protein 3,CTL3,SLC44A3,Solute carrier family 44 member 3
EIAAB09826 Bos taurus,Bovine,Choline transporter-like protein 2,CTL2,SLC44A2,Solute carrier family 44 member 2
EIAAB09842 Choline transporter-like protein 5,Ctl5,Mouse,Mus musculus,Slc44a5,Solute carrier family 44 member 5
EIAAB09825 Choline transporter-like protein 2,Ctl2,Mouse,Mus musculus,Slc44a2,Solute carrier family 44 member 2
EIAAB09841 Choline transporter-like protein 5,CTL5,Homo sapiens,Human,SLC44A5,Solute carrier family 44 member 5
EIAAB09836 Choline transporter-like protein 4,Ctl4,Ng22,Rat,Rattus norvegicus,Slc44a4,Solute carrier family 44 member 4
EIAAB09839 Choline transporter-like protein 4,Ctl4,Mouse,Mus musculus,Ng22,Slc44a4,Solute carrier family 44 member 4
EIAAB09835 Choline transporter-like protein 3,CTL3,Homo sapiens,Human,SLC44A3,Solute carrier family 44 member 3,UNQ558_PRO1115
EIAAB09822 Cd92,Cdw92,Choline transporter-like protein 1,Ctl1,Rat,Rattus norvegicus,Slc44a1,Solute carrier family 44 member 1
EIAAB09827 Choline transporter-like protein 2,CTL2,Homo sapiens,Human,PSEC0210,SLC44A2,Solute carrier family 44 member 2
EIAAB09824 Cd92,Cdw92,Choline transporter-like protein 1,Ctl1,Mouse,Mus musculus,Slc44a1,Solute carrier family 44 member 1
EIAAB39156 Homo sapiens,Human,OATP2A1,PGT,Prostaglandin transporter,SLC21A2,SLCO2A1,Solute carrier family 21 member 2,Solute carrier organic anion transporter family member 2A1
EIAAB39157 Matr1,Matrin F_G 1,PGT,Prostaglandin transporter,Rat,Rattus norvegicus,Slc21a2,Slco2a1,Solute carrier family 21 member 2,Solute carrier organic anion transporter family member 2A1
EIAAB39155 Mouse,Mus musculus,Oatp2a1,PGT,Prostaglandin transporter,Slc21a2,Slco2a1,Solute carrier family 21 member 2,Solute carrier organic anion transporter family member 2A1
EIAAB09840 C6orf29,Choline transporter-like protein 4,CTL4,Homo sapiens,Human,NG22,SLC44A4,Solute carrier family 44 member 4,UNQ441_PRO874
EIAAB39171 Homo sapiens,Human,OATP5A1,OATPRP4,OATP-RP4,Organic anion transporter polypeptide-related protein 4,SLC21A15,SLCO5A1,Solute carrier family 21 member 15,Solute carrier organic anion transporter family


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur