Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Cyclic AMP-dependent transcription factor ATF-3 (cAMP-dependent transcription factor ATF-3) (Activating transcription factor 3)

 ATF3_HUMAN              Reviewed;         181 AA.
P18847; Q5VTZ2; Q6ICQ9; Q7Z566; Q8WYM6;
01-NOV-1990, integrated into UniProtKB/Swiss-Prot.
01-NOV-1995, sequence version 2.
22-NOV-2017, entry version 182.
RecName: Full=Cyclic AMP-dependent transcription factor ATF-3;
Short=cAMP-dependent transcription factor ATF-3;
AltName: Full=Activating transcription factor 3;
Name=ATF3;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
PubMed=7515060;
Chen B.P.C., Liang G., Whelan J., Hai T.;
"ATF3 and ATF3 delta Zip. Transcriptional repression versus activation
by alternatively spliced isoforms.";
J. Biol. Chem. 269:15819-15826(1994).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), SUBCELLULAR LOCATION, AND
ALTERNATIVE SPLICING.
PubMed=12034827; DOI=10.1093/nar/30.11.2398;
Hashimoto Y., Zhang C., Kawauchi J., Imoto I., Adachi M.T.,
Inazawa J., Amagasa T., Hai T., Kitajima S.;
"An alternatively spliced isoform of transcriptional repressor ATF3
and its induction by stress stimuli.";
Nucleic Acids Res. 30:2398-2406(2002).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), AND ALTERNATIVE SPLICING.
PubMed=12881527; DOI=10.1074/jbc.M304574200;
Pan Y., Chen H., Siu F., Kilberg M.S.;
"Amino acid deprivation and endoplasmic reticulum stress induce
expression of multiple activating transcription factor-3 mRNA species
that, when overexpressed in HepG2 cells, modulate transcription by the
human asparagine synthetase promoter.";
J. Biol. Chem. 278:38402-38412(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANT MET-38.
NIEHS SNPs program;
Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 1-147 (ISOFORM 5).
TISSUE=Cerebellum, and Lung;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
"Cloning of human full open reading frames in Gateway(TM) system entry
vector (pDONR201).";
Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Muscle;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[11]
NUCLEOTIDE SEQUENCE [MRNA] OF 25-181.
PubMed=2516827; DOI=10.1101/gad.3.12b.2083;
Hai T., Liu F., Coukos W.J., Green M.R.;
"Transcription factor ATF cDNA clones: an extensive family of leucine
zipper proteins able to selectively form DNA-binding heterodimers.";
Genes Dev. 3:2083-2090(1989).
[12]
ERRATUM.
Hai T., Liu F., Coukos W.J., Green M.R.;
Genes Dev. 4:682-682(1990).
[13]
SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
PubMed=14759258; DOI=10.1186/gb-2004-5-2-r8;
Hillman R.T., Green R.E., Brenner S.E.;
"An unappreciated role for RNA surveillance.";
Genome Biol. 5:R8.1-R8.16(2004).
[14]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-162, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[15]
SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-78 AND LYS-175, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=28112733; DOI=10.1038/nsmb.3366;
Hendriks I.A., Lyon D., Young C., Jensen L.J., Vertegaal A.C.,
Nielsen M.L.;
"Site-specific mapping of the human SUMO proteome reveals co-
modification with phosphorylation.";
Nat. Struct. Mol. Biol. 24:325-336(2017).
-!- FUNCTION: This protein binds the cAMP response element (CRE)
(consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many
viral and cellular promoters. Represses transcription from
promoters with ATF sites. It may repress transcription by
stabilizing the binding of inhibitory cofactors at the promoter.
Isoform 2 activates transcription presumably by sequestering
inhibitory cofactors away from the promoters.
-!- SUBUNIT: Binds DNA as a homodimer or a heterodimer.
-!- INTERACTION:
Self; NbExp=2; IntAct=EBI-712767, EBI-712767;
P15336:ATF2; NbExp=2; IntAct=EBI-712767, EBI-1170906;
P18848:ATF4; NbExp=7; IntAct=EBI-712767, EBI-492498;
P17544:ATF7; NbExp=2; IntAct=EBI-712767, EBI-765623;
Q9NR55:BATF3; NbExp=2; IntAct=EBI-712767, EBI-10312707;
P53567:CEBPG; NbExp=2; IntAct=EBI-712767, EBI-740209;
P35638:DDIT3; NbExp=4; IntAct=EBI-712767, EBI-742651;
Q14192:FHL2; NbExp=3; IntAct=EBI-712767, EBI-701903;
P05412:JUN; NbExp=7; IntAct=EBI-712767, EBI-852823;
P17275:JUNB; NbExp=2; IntAct=EBI-712767, EBI-748062;
P17535:JUND; NbExp=2; IntAct=EBI-712767, EBI-2682803;
O95644:NFATC1; NbExp=2; IntAct=EBI-712767, EBI-6907210;
Q04206:RELA; NbExp=5; IntAct=EBI-9844134, EBI-73886;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-
ProRule:PRU00978, ECO:0000269|PubMed:12034827}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1; Synonyms=ATF3;
IsoId=P18847-1; Sequence=Displayed;
Name=2; Synonyms=ATF3-delta-Zip;
IsoId=P18847-2; Sequence=VSP_000592;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=3; Synonyms=ATF3-delta-Zip2a/TF3-delta-Zip2b;
IsoId=P18847-3; Sequence=VSP_043150;
Note=Stress-induced isoform, counteracts the transcriptional
repression of isoform 1.;
Name=4; Synonyms=ATF3-delta-Zip2c;
IsoId=P18847-4; Sequence=VSP_043182, VSP_043150;
Name=5;
IsoId=P18847-5; Sequence=VSP_046966;
-!- SIMILARITY: Belongs to the bZIP family. ATF subfamily.
{ECO:0000305}.
-!- WEB RESOURCE: Name=NIEHS-SNPs;
URL="http://egp.gs.washington.edu/data/atf3/";
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
URL="http://atlasgeneticsoncology.org/Genes/ATF3ID719ch1q32.html";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; L19871; AAA20506.1; -; mRNA.
EMBL; AB066566; BAB84092.1; -; mRNA.
EMBL; AB078026; BAC00495.1; -; mRNA.
EMBL; AB078027; BAC00496.1; -; mRNA.
EMBL; AY313927; AAP93896.1; -; mRNA.
EMBL; BT006996; AAP35642.1; -; mRNA.
EMBL; AY426987; AAQ93358.1; -; Genomic_DNA.
EMBL; AK312998; BAG35834.1; -; mRNA.
EMBL; DA589280; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; CR450334; CAG29330.1; -; mRNA.
EMBL; AC092803; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL590648; CAH72653.1; -; Genomic_DNA.
EMBL; AL590648; CAH72654.1; -; Genomic_DNA.
EMBL; AL590648; CAH72656.1; -; Genomic_DNA.
EMBL; AL606913; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471100; EAW93385.1; -; Genomic_DNA.
EMBL; CH471100; EAW93386.1; -; Genomic_DNA.
EMBL; CH471100; EAW93387.1; -; Genomic_DNA.
EMBL; CH471100; EAW93388.1; -; Genomic_DNA.
EMBL; BC006322; AAH06322.1; -; mRNA.
CCDS; CCDS1506.1; -. [P18847-1]
CCDS; CCDS41464.1; -. [P18847-3]
CCDS; CCDS55688.1; -. [P18847-4]
CCDS; CCDS58059.1; -. [P18847-5]
PIR; A54025; A54025.
PIR; B54025; B54025.
PIR; C34223; C34223.
RefSeq; NP_001025458.1; NM_001030287.3. [P18847-1]
RefSeq; NP_001035709.1; NM_001040619.2. [P18847-3]
RefSeq; NP_001193413.2; NM_001206484.2. [P18847-5]
RefSeq; NP_001193415.1; NM_001206486.2. [P18847-4]
RefSeq; NP_001193417.2; NM_001206488.2. [P18847-5]
RefSeq; NP_001665.1; NM_001674.3. [P18847-1]
RefSeq; XP_005273203.1; XM_005273146.1. [P18847-1]
RefSeq; XP_011507881.1; XM_011509579.1. [P18847-1]
UniGene; Hs.460; -.
ProteinModelPortal; P18847; -.
SMR; P18847; -.
BioGrid; 106957; 60.
CORUM; P18847; -.
DIP; DIP-344N; -.
IntAct; P18847; 34.
MINT; MINT-4649546; -.
STRING; 9606.ENSP00000344352; -.
DrugBank; DB00852; Pseudoephedrine.
iPTMnet; P18847; -.
PhosphoSitePlus; P18847; -.
BioMuta; ATF3; -.
DMDM; 1168543; -.
EPD; P18847; -.
PaxDb; P18847; -.
PeptideAtlas; P18847; -.
PRIDE; P18847; -.
TopDownProteomics; P18847-1; -. [P18847-1]
DNASU; 467; -.
Ensembl; ENST00000336937; ENSP00000336908; ENSG00000162772. [P18847-4]
Ensembl; ENST00000341491; ENSP00000344352; ENSG00000162772. [P18847-1]
Ensembl; ENST00000366983; ENSP00000355950; ENSG00000162772. [P18847-3]
Ensembl; ENST00000366987; ENSP00000355954; ENSG00000162772. [P18847-1]
Ensembl; ENST00000464547; ENSP00000432208; ENSG00000162772. [P18847-3]
Ensembl; ENST00000613104; ENSP00000480606; ENSG00000162772. [P18847-5]
Ensembl; ENST00000613954; ENSP00000483576; ENSG00000162772. [P18847-5]
GeneID; 467; -.
KEGG; hsa:467; -.
UCSC; uc001hjf.4; human. [P18847-1]
CTD; 467; -.
DisGeNET; 467; -.
EuPathDB; HostDB:ENSG00000162772.16; -.
GeneCards; ATF3; -.
HGNC; HGNC:785; ATF3.
HPA; HPA001562; -.
MIM; 603148; gene.
neXtProt; NX_P18847; -.
OpenTargets; ENSG00000162772; -.
PharmGKB; PA25085; -.
eggNOG; KOG1414; Eukaryota.
eggNOG; ENOG4111CH5; LUCA.
GeneTree; ENSGT00730000110847; -.
HOGENOM; HOG000034126; -.
HOVERGEN; HBG003381; -.
InParanoid; P18847; -.
KO; K09032; -.
OMA; LVYMLNL; -.
OrthoDB; EOG091G0M4N; -.
PhylomeDB; P18847; -.
TreeFam; TF326301; -.
Reactome; R-HSA-380994; ATF4 activates genes.
SignaLink; P18847; -.
SIGNOR; P18847; -.
ChiTaRS; ATF3; human.
GeneWiki; ATF3; -.
GenomeRNAi; 467; -.
PRO; PR:P18847; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000162772; -.
CleanEx; HS_ATF3; -.
ExpressionAtlas; P18847; baseline and differential.
Genevisible; P18847; HS.
GO; GO:1990622; C:CHOP-ATF3 complex; IDA:ParkinsonsUK-UCL.
GO; GO:0005730; C:nucleolus; IDA:HPA.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; IDA:ParkinsonsUK-UCL.
GO; GO:0042802; F:identical protein binding; IPI:IntAct.
GO; GO:0046982; F:protein heterodimerization activity; IPI:ParkinsonsUK-UCL.
GO; GO:0042803; F:protein homodimerization activity; IDA:ParkinsonsUK-UCL.
GO; GO:0000978; F:RNA polymerase II core promoter proximal region sequence-specific DNA binding; IEA:Ensembl.
GO; GO:0000977; F:RNA polymerase II regulatory region sequence-specific DNA binding; IDA:NTNU_SB.
GO; GO:0003714; F:transcription corepressor activity; TAS:ProtInc.
GO; GO:0003700; F:transcription factor activity, sequence-specific DNA binding; IGI:ParkinsonsUK-UCL.
GO; GO:0044212; F:transcription regulatory region DNA binding; IDA:ParkinsonsUK-UCL.
GO; GO:0000976; F:transcription regulatory region sequence-specific DNA binding; IDA:ParkinsonsUK-UCL.
GO; GO:0001228; F:transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding; IC:NTNU_SB.
GO; GO:0001078; F:transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding; IEA:Ensembl.
GO; GO:0034198; P:cellular response to amino acid starvation; IEA:Ensembl.
GO; GO:0006094; P:gluconeogenesis; IEA:Ensembl.
GO; GO:0070373; P:negative regulation of ERK1 and ERK2 cascade; IEA:Ensembl.
GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IDA:ParkinsonsUK-UCL.
GO; GO:0036499; P:PERK-mediated unfolded protein response; TAS:Reactome.
GO; GO:0008284; P:positive regulation of cell proliferation; IEA:Ensembl.
GO; GO:1903984; P:positive regulation of TRAIL-activated apoptotic signaling pathway; IMP:ParkinsonsUK-UCL.
GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; IDA:NTNU_SB.
GO; GO:1990440; P:positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress; IDA:ParkinsonsUK-UCL.
GO; GO:0061394; P:regulation of transcription from RNA polymerase II promoter in response to arsenic-containing substance; TAS:ParkinsonsUK-UCL.
GO; GO:0035914; P:skeletal muscle cell differentiation; IEA:Ensembl.
Gene3D; 1.10.880.10; -; 1.
InterPro; IPR000837; AP-1.
InterPro; IPR029812; ATF3.
InterPro; IPR004827; bZIP.
InterPro; IPR008917; TF_DNA-bd_sf.
PANTHER; PTHR23351; PTHR23351; 1.
PANTHER; PTHR23351:SF23; PTHR23351:SF23; 1.
Pfam; PF00170; bZIP_1; 1.
PRINTS; PR00042; LEUZIPPRFOS.
SMART; SM00338; BRLZ; 1.
PROSITE; PS50217; BZIP; 1.
PROSITE; PS00036; BZIP_BASIC; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; DNA-binding; Isopeptide bond;
Nucleus; Phosphoprotein; Polymorphism; Reference proteome; Repressor;
Transcription; Transcription regulation; Ubl conjugation.
CHAIN 1 181 Cyclic AMP-dependent transcription factor
ATF-3.
/FTId=PRO_0000076581.
DOMAIN 86 149 bZIP. {ECO:0000255|PROSITE-
ProRule:PRU00978}.
REGION 88 110 Basic motif. {ECO:0000255|PROSITE-
ProRule:PRU00978}.
REGION 114 142 Leucine-zipper. {ECO:0000255|PROSITE-
ProRule:PRU00978}.
MOD_RES 162 162 Phosphothreonine.
{ECO:0000244|PubMed:23186163}.
CROSSLNK 78 78 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000244|PubMed:28112733}.
CROSSLNK 175 175 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000244|PubMed:28112733}.
VAR_SEQ 1 57 Missing (in isoform 5).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_046966.
VAR_SEQ 14 42 Missing (in isoform 4).
{ECO:0000303|PubMed:12881527}.
/FTId=VSP_043182.
VAR_SEQ 116 181 KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVR
AQNGRTPEDERNLFIQQIKEGTLQS -> LQY (in
isoform 2). {ECO:0000303|PubMed:7515060}.
/FTId=VSP_000592.
VAR_SEQ 117 181 ESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRA
QNGRTPEDERNLFIQQIKEGTLQS -> LPRPFWVQKTCIW
AVDSCK (in isoform 3 and isoform 4).
{ECO:0000303|PubMed:12034827,
ECO:0000303|PubMed:12881527}.
/FTId=VSP_043150.
VARIANT 38 38 T -> M (in dbSNP:rs11571541).
{ECO:0000269|Ref.5}.
/FTId=VAR_048442.
CONFLICT 132 132 I -> L (in Ref. 11; no nucleotide entry).
{ECO:0000305}.
SEQUENCE 181 AA; 20576 MW; EC5D8F065EEE2D9C CRC64;
MMLQHPGQVS ASEVSASAIV PCLSPPGSLV FEDFANLTPF VKEELRFAIQ NKHLCHRMSS
ALESVTVSDR PLGVSITKAE VAPEEDERKK RRRERNKIAA AKCRNKKKEK TECLQKESEK
LESVNAELKA QIEELKNEKQ HLIYMLNLHR PTCIVRAQNG RTPEDERNLF IQQIKEGTLQ
S


Related products :

Catalog number Product name Quantity
U1346h CLIA Activating transcription factor 1,ATF1,cAMP-dependent transcription factor ATF-1,Cyclic AMP-dependent transcription factor ATF-1,Homo sapiens,Human,Protein TREB36 96T
E1346h ELISA kit Activating transcription factor 1,ATF1,cAMP-dependent transcription factor ATF-1,Cyclic AMP-dependent transcription factor ATF-1,Homo sapiens,Human,Protein TREB36 96T
E1346h ELISA Activating transcription factor 1,ATF1,cAMP-dependent transcription factor ATF-1,Cyclic AMP-dependent transcription factor ATF-1,Homo sapiens,Human,Protein TREB36 96T
U1346b CLIA Activating transcription factor 1,ATF1,Bos taurus,Bovine,cAMP-dependent transcription factor ATF-1,Cyclic AMP-dependent transcription factor ATF-1 96T
E1346b ELISA Activating transcription factor 1,ATF1,Bos taurus,Bovine,cAMP-dependent transcription factor ATF-1,Cyclic AMP-dependent transcription factor ATF-1 96T
E1346b ELISA kit Activating transcription factor 1,ATF1,Bos taurus,Bovine,cAMP-dependent transcription factor ATF-1,Cyclic AMP-dependent transcription factor ATF-1 96T
E1346m ELISA Activating transcription factor 1,Atf1,cAMP-dependent transcription factor ATF-1,Cyclic AMP-dependent transcription factor ATF-1,Mouse,Mus musculus,TCR-ATF1 96T
U1346m CLIA Activating transcription factor 1,Atf1,cAMP-dependent transcription factor ATF-1,Cyclic AMP-dependent transcription factor ATF-1,Mouse,Mus musculus,TCR-ATF1 96T
E1346m ELISA kit Activating transcription factor 1,Atf1,cAMP-dependent transcription factor ATF-1,Cyclic AMP-dependent transcription factor ATF-1,Mouse,Mus musculus,TCR-ATF1 96T
10-782-55004 Cyclic AMP-dependent transcription factor ATF-2 - Activating transcription factor 2; cAMP response element-binding protein CRE-BP1; HB16 N_A 0.2 mg
10-782-55004 Cyclic AMP-dependent transcription factor ATF-2 - Activating transcription factor 2; cAMP response element-binding protein CRE-BP1; HB16 N_A 0.05 mg
18-003-42489 Cyclic AMP-dependent transcription factor ATF-2 - Activating transcription factor 2; cAMP response element-binding protein CRE-BP1; HB16 Polyclonal 0.1 mg Protein A
18-662-20064 Cyclic AMP-dependent transcription factor ATF-2 - Activating transcription factor 2; cAMP response element-binding protein CRE-BP1; HB16 Polyclonal 0.1 ml
18-003-42999 Cyclic AMP-dependent transcription factor ATF-5 - Activating transcription factor 5; Transcription factor ATFx Polyclonal 0.05 mg Aff Pur
18-003-43256 Cyclic AMP-dependent transcription factor ATF-7 - Activating transcription factor 7; Transcription factor ATF-A Polyclonal 0.1 mg Protein A
18-003-43222 Cyclic AMP-dependent transcription factor ATF-1 - Activating transcription factor 1; TREB36 protein Polyclonal 0.05 mg Aff Pur
18-003-44064 Cyclic AMP-dependent transcription factor ATF-4 - Activating transcription factor 4; DNA-binding protein TAXREB67; Cyclic AMP response element-binding protein 2; CREB2 Polyclonal 0.1 mg Protein A
27-359 TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription. 0.05 mg
10-663-45549 Activating Transcription Factor-2 (ATF-2) Human - Activating transcription factor 2; cAMP response element-binding protein CRE-BP1; HB16 N_A 0.002 mg
10-663-45549 Activating Transcription Factor-2 (ATF-2) Human - Activating transcription factor 2; cAMP response element-binding protein CRE-BP1; HB16 N_A 1 mg
10-663-45549 Activating Transcription Factor-2 (ATF-2) Human - Activating transcription factor 2; cAMP response element-binding protein CRE-BP1; HB16 N_A 0.01 mg
EIAAB41105 ATP-dependent helicase GTF2F2,General transcription factor IIF 30 kDa subunit,General transcription factor IIF subunit 2,GTF2F2,Homo sapiens,Human,RAP30,TFIIF-beta,Transcription initiation factor IIF
20-372-60012 activating transcription factor 2 (ATF2) - Mouse monoclonal anti-human ATF2 antibody; Activating transcription factor 2; cAMP response element-binding protein CRE-BP1; HB16 Monoclonal 0.1 mg
EIAAB42084 Homo sapiens,Human,Mitochondrial transcription factor 1,MtTF1,mtTFA,TCF6,TCF-6,TCF6L2,TFAM,Transcription factor 6,Transcription factor 6-like 2,Transcription factor A, mitochondrial
18-003-42098 Ets domain transcription factor - ESE3 transcription factor; EHF protein; DJ875K15.1.2 (Ets homologous factor (Ets-domain transcription factor. ESE-3B (Isoform 2))); ETS-family transcription factor EH 0.1 mg Protein A


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur