Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Cyclic nucleotide-gated cation channel alpha-4 (Cyclic nucleotide-gated channel alpha-4) (CNG channel alpha-4) (CNG-4) (CNG4)

 CNGA4_HUMAN             Reviewed;         575 AA.
Q8IV77;
05-FEB-2008, integrated into UniProtKB/Swiss-Prot.
02-NOV-2010, sequence version 3.
25-OCT-2017, entry version 122.
RecName: Full=Cyclic nucleotide-gated cation channel alpha-4;
AltName: Full=Cyclic nucleotide-gated channel alpha-4;
Short=CNG channel alpha-4;
Short=CNG-4;
Short=CNG4;
Name=CNGA4;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16554811; DOI=10.1038/nature04632;
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K.,
Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F.,
Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E.,
FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S.,
Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W.,
Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S.,
Sakaki Y.;
"Human chromosome 11 DNA sequence and analysis including novel gene
identification.";
Nature 440:497-500(2006).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Brain, and Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
SUBUNIT, AND MUTAGENESIS OF LEU-292.
PubMed=15195096; DOI=10.1038/nn1266;
Bradley J., Boenigk W., Yau K.-W., Frings S.;
"Calmodulin permanently associates with rat olfactory CNG channels
under native conditions.";
Nat. Neurosci. 7:705-710(2004).
[5]
ENZYME REGULATION.
PubMed=17032767; DOI=10.1073/pnas.0603344103;
Brady J.D., Rich E.D., Martens J.R., Karpen J.W., Varnum M.D.,
Brown R.L.;
"Interplay between PIP3 and calmodulin regulation of olfactory cyclic
nucleotide-gated channels.";
Proc. Natl. Acad. Sci. U.S.A. 103:15635-15640(2006).
-!- FUNCTION: Second messenger, cAMP, causes the opening of cation-
selective cyclic nucleotide-gated (CNG) channels and
depolarization of the neuron (olfactory sensory neurons, OSNs).
CNGA4 is the modulatory subunit of this channel which is known to
play a central role in the transduction of odorant signals and
subsequent adaptation. By accelerating the calcium-mediated
negative feedback in olfactory signaling it allows rapid
adaptation to odor stimulation and extends its range of odor
detection (By similarity). {ECO:0000250}.
-!- ENZYME REGULATION: Calcium-calmodulin exerts its inhibitory effect
in cAMP sensitivity by binding to IQ-like motif of CNGA4 and
preferably binds to the channel in the closed state. Inhibition by
PIP3 of the CNG channel probably occurs via CGNA2 binding.
{ECO:0000269|PubMed:17032767}.
-!- SUBUNIT: Heterotetramer composed of two subunits of CNGA2, one of
CNGA4 and one of CNGB1b. The complex forms the cyclic nucleotide-
gated (CNG) channel of olfactory sensory neurons.
{ECO:0000269|PubMed:15195096}.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Multi-pass membrane
protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q8IV77-1; Sequence=Displayed;
Name=2;
IsoId=Q8IV77-2; Sequence=VSP_039919, VSP_039920, VSP_039921;
Note=No experimental confirmation available.;
-!- DOMAIN: The C-terminal coiled-coil domain mediates trimerization
of CNGA subunits. {ECO:0000250}.
-!- SIMILARITY: Belongs to the cyclic nucleotide-gated cation channel
(TC 1.A.1.5) family. CNGA4 subfamily. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAH40277.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Sequence=AK122736; Type=Frameshift; Positions=154; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AK122736; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AC022762; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC040277; AAH40277.1; ALT_INIT; mRNA.
EMBL; BC106935; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; BC106936; -; NOT_ANNOTATED_CDS; mRNA.
CCDS; CCDS31408.1; -. [Q8IV77-1]
RefSeq; NP_001032406.1; NM_001037329.3. [Q8IV77-1]
UniGene; Hs.434618; -.
ProteinModelPortal; Q8IV77; -.
SMR; Q8IV77; -.
BioGrid; 107662; 30.
STRING; 9606.ENSP00000369268; -.
iPTMnet; Q8IV77; -.
PhosphoSitePlus; Q8IV77; -.
BioMuta; CNGA4; -.
DMDM; 311033466; -.
PaxDb; Q8IV77; -.
PeptideAtlas; Q8IV77; -.
PRIDE; Q8IV77; -.
DNASU; 1262; -.
Ensembl; ENST00000379936; ENSP00000369268; ENSG00000132259. [Q8IV77-1]
GeneID; 1262; -.
KEGG; hsa:1262; -.
UCSC; uc001mco.4; human. [Q8IV77-1]
CTD; 1262; -.
EuPathDB; HostDB:ENSG00000132259.12; -.
GeneCards; CNGA4; -.
H-InvDB; HIX0026152; -.
HGNC; HGNC:2152; CNGA4.
MIM; 609472; gene.
neXtProt; NX_Q8IV77; -.
OpenTargets; ENSG00000132259; -.
eggNOG; KOG0500; Eukaryota.
eggNOG; ENOG410YWWI; LUCA.
GeneTree; ENSGT00900000140801; -.
HOGENOM; HOG000007898; -.
HOVERGEN; HBG000281; -.
InParanoid; Q8IV77; -.
KO; K04951; -.
OMA; TREWPMP; -.
OrthoDB; EOG091G03EW; -.
PhylomeDB; Q8IV77; -.
TreeFam; TF319048; -.
Reactome; R-HSA-5620916; VxPx cargo-targeting to cilium.
GeneWiki; Cyclic_nucleotide-gated_channel_alpha_4; -.
GenomeRNAi; 1262; -.
PRO; PR:Q8IV77; -.
Proteomes; UP000005640; Chromosome 11.
Bgee; ENSG00000132259; -.
CleanEx; HS_CNGA4; -.
ExpressionAtlas; Q8IV77; baseline and differential.
Genevisible; Q8IV77; HS.
GO; GO:0060170; C:ciliary membrane; TAS:Reactome.
GO; GO:0000139; C:Golgi membrane; TAS:Reactome.
GO; GO:0030660; C:Golgi-associated vesicle membrane; TAS:Reactome.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0030552; F:cAMP binding; IEA:UniProtKB-KW.
GO; GO:0005249; F:voltage-gated potassium channel activity; IBA:GO_Central.
GO; GO:0042391; P:regulation of membrane potential; IBA:GO_Central.
GO; GO:0050896; P:response to stimulus; IEA:UniProtKB-KW.
GO; GO:0007608; P:sensory perception of smell; IEA:UniProtKB-KW.
CDD; cd00038; CAP_ED; 1.
Gene3D; 2.60.120.10; -; 1.
InterPro; IPR032406; CLZ_dom.
InterPro; IPR018490; cNMP-bd-like.
InterPro; IPR018488; cNMP-bd_CS.
InterPro; IPR000595; cNMP-bd_dom.
InterPro; IPR005821; Ion_trans_dom.
InterPro; IPR014710; RmlC-like_jellyroll.
Pfam; PF16526; CLZ; 1.
Pfam; PF00027; cNMP_binding; 1.
Pfam; PF00520; Ion_trans; 1.
SMART; SM00100; cNMP; 1.
SUPFAM; SSF51206; SSF51206; 1.
PROSITE; PS00888; CNMP_BINDING_1; 1.
PROSITE; PS00889; CNMP_BINDING_2; 1.
PROSITE; PS50042; CNMP_BINDING_3; 1.
1: Evidence at protein level;
Alternative splicing; cAMP; cAMP-binding; Coiled coil;
Complete proteome; Ion channel; Ion transport;
Ligand-gated ion channel; Membrane; Nucleotide-binding; Olfaction;
Polymorphism; Reference proteome; Sensory transduction; Transmembrane;
Transmembrane helix; Transport.
CHAIN 1 575 Cyclic nucleotide-gated cation channel
alpha-4.
/FTId=PRO_0000317107.
TOPO_DOM 1 33 Cytoplasmic. {ECO:0000255}.
TRANSMEM 34 54 Helical; Name=H1. {ECO:0000255}.
TOPO_DOM 55 65 Extracellular. {ECO:0000255}.
TRANSMEM 66 86 Helical; Name=H2. {ECO:0000255}.
TOPO_DOM 87 112 Cytoplasmic. {ECO:0000255}.
TRANSMEM 113 133 Helical; Name=H3. {ECO:0000255}.
TOPO_DOM 134 168 Extracellular. {ECO:0000255}.
TRANSMEM 169 189 Helical; Name=H4. {ECO:0000255}.
TOPO_DOM 190 217 Cytoplasmic. {ECO:0000255}.
TRANSMEM 218 234 Helical; Name=H5. {ECO:0000255}.
TOPO_DOM 235 244 Extracellular. {ECO:0000255}.
TRANSMEM 245 265 Helical; Name=H6. {ECO:0000255}.
TOPO_DOM 266 575 Cytoplasmic. {ECO:0000255}.
NP_BIND 348 471 cNMP.
COILED 493 536 {ECO:0000250}.
MOTIF 292 302 IQ-type.
VAR_SEQ 1 40 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_039919.
VAR_SEQ 424 456 NMSGNRRTANIKSLGYSDLFCLSKEDLREVLSE -> GYPS
ICSRDKDGWGRGEQQSPVLGPDSTSGLNF (in isoform
2). {ECO:0000303|PubMed:15489334}.
/FTId=VSP_039920.
VAR_SEQ 457 575 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_039921.
VARIANT 553 553 E -> V (in dbSNP:rs325706).
/FTId=VAR_038480.
MUTAGEN 292 292 L->E: Loss of inhibition produced by
calcium/calmodulin binding.
{ECO:0000269|PubMed:15195096}.
SEQUENCE 575 AA; 65999 MW; 4249188A8563A461 CRC64;
MSQDTKVKTT ESSPPAPSKA RKLLPVLDPS GDYYYWWLNT MVFPVMYNLI ILVCRACFPD
LQHGYLVAWL VLDYTSDLLY LLDMVVRFHT GFLEQGILVV DKGRISSRYV RTWSFFLDLA
SLMPTDVVYV RLGPHTPTLR LNRFLRAPRL FEAFDRTETR TAYPNAFRIA KLMLYIFVVI
HWNSCLYFAL SRYLGFGRDA WVYPDPAQPG FERLRRQYLY SFYFSTLILT TVGDTPPPAR
EEEYLFMVGD FLLAVMGFAT IMGSMSSVIY NMNTADAAFY PDHALVKKYM KLQHVNRKLE
RRVIDWYQHL QINKKMTNEV AILQHLPERL RAEVAVSVHL STLSRVQIFQ NCEASLLEEL
VLKLQPQTYS PGEYVCRKGD IGQEMYIIRE GQLAVVADDG ITQYAVLGAG LYFGEISIIN
IKGNMSGNRR TANIKSLGYS DLFCLSKEDL REVLSEYPQA QTIMEEKGRE ILLKMNKLDV
NAEAAEIALQ EATESRLRGL DQQLDDLQTK FARLLAELES SALKIAYRIE RLEWQTREWP
MPEDLAEADD EGEPEEGTSK DEEGRASQEG PPGPE


Related products :

Catalog number Product name Quantity
EIAAB08182 Cgn2,CNG channel alpha-4,CNG4,CNG-4,Cnga4,Cyclic nucleotide-gated cation channel alpha-4,Cyclic nucleotide-gated channel alpha-4,Cyclic nucleotide-gated olfactory channel subunit OCNC2,Rat,Rattus norv
EIAAB08175 CNCA,CNCA1,CNCG2,CNG channel alpha-2,CNG2,CNG-2,CNGA2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel,Homo sapiens,Human
EIAAB08177 Aorta CNG channel,CNCG2,CNG channel alpha-2,CNG2,CNG-2,CNGA2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel,Oryctolagus cuni
EIAAB08169 cGMP-gated cation channel alpha-1,CNCG,CNCG1,CNG channel alpha-1,CNG1,CNG-1,CNGA1,Cyclic nucleotide-gated cation channel 1,Cyclic nucleotide-gated channel alpha-1,Cyclic nucleotide-gated channel, phot
EIAAB08171 cGMP-gated cation channel alpha-1,Cncg,Cncg1,CNG channel alpha-1,CNG1,CNG-1,Cnga1,Cyclic nucleotide-gated cation channel 1,Cyclic nucleotide-gated channel alpha-1,Cyclic nucleotide-gated channel, phot
EIAAB08172 cGMP-gated cation channel alpha-1,Cncg,Cncg1,CNG channel alpha-1,CNG1,CNG-1,Cnga1,Cyclic nucleotide-gated cation channel 1,Cyclic nucleotide-gated channel alpha-1,Cyclic nucleotide-gated channel, phot
EIAAB08173 Bos taurus,Bovine,cGMP-gated cation channel alpha-1,CNCG,CNCG1,CNG channel alpha-1,CNG1,CNG-1,CNGA1,Cyclic nucleotide-gated cation channel 1,Cyclic nucleotide-gated channel alpha-1,Cyclic nucleotide-g
EIAAB08181 CNCG3,CNG channel alpha-3,CNG3,CNG-3,CNGA3,Cone photoreceptor cGMP-gated channel subunit alpha,Cyclic nucleotide-gated cation channel alpha-3,Cyclic nucleotide-gated channel alpha-3,Homo sapiens,Human
EIAAB08174 Cncg2,Cncg4,CNG channel alpha-2,CNG2,CNG-2,Cnga2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel,Mouse,Mus musculus
EIAAB08179 Bos taurus,Bovine,CNCG3,CNG channel alpha-3,CNG3,CNG-3,CNGA3,Cone photoreceptor cGMP-gated channel subunit alpha,Cyclic nucleotide-gated cation channel alpha-3,Cyclic nucleotide-gated channel alpha-3
EIAAB08183 CNG channel alpha-4,CNG4,CNG-4,CNGA4,Cyclic nucleotide-gated cation channel alpha-4,Cyclic nucleotide-gated channel alpha-4,Homo sapiens,Human
EIAAB08178 Bos taurus,Bovine,CNCG2,CNG channel alpha-2,CNG2,CNG-2,CNGA2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel
EIAAB08184 CNG channel alpha-4,CNG4,CNG-4,Cnga4,Cyclic nucleotide-gated cation channel alpha-4,Cyclic nucleotide-gated channel alpha-4,Mouse,Mus musculus
EIAAB08180 CNG channel alpha-3,CNG3,Cng3,CNG-3,Cnga3,Cone photoreceptor cGMP-gated channel subunit alpha,Cyclic nucleotide-gated cation channel alpha-3,Cyclic nucleotide-gated channel alpha-3,Mouse,Mus musculus
EIAAB08186 CNCG2,CNCG3L,CNCG4,CNG channel 4,CNG channel beta-1,CNG4,CNG-4,CNGB1,Cyclic nucleotide-gated cation channel 4,Cyclic nucleotide-gated cation channel beta-1,Cyclic nucleotide-gated cation channel gamma
EIAAB08176 Cncg2,CNG channel alpha-2,CNG2,CNG-2,Cnga2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel,Cyclic nucleotide-gated olfactory
EIAAB08185 240 kDa protein of rod photoreceptor CNG-channel,Bos taurus,Bovine,CNCG4,CNG channel 4,CNG channel beta-1,CNG4,CNG-4,CNGB1,Cyclic nucleotide-gated cation channel 4,Cyclic nucleotide-gated cation chann
EIAAB08170 Canis familiaris,Canis lupus familiaris,cGMP-gated cation channel alpha-1,CNCG,CNCG1,CNG channel alpha-1,CNG1,CNG-1,CNGA1,Cyclic nucleotide-gated cation channel 1,Cyclic nucleotide-gated channel alpha
EIAAB08189 CNG channel beta-3,Cng6,Cngb3,Cone photoreceptor cGMP-gated channel subunit beta,Cyclic nucleotide-gated cation channel beta-3,Cyclic nucleotide-gated cation channel modulatory subunit,Cyclic nucleoti
EIAAB08188 CNG channel beta-3,CNGB3,Cone photoreceptor cGMP-gated channel subunit beta,Cyclic nucleotide-gated cation channel beta-3,Cyclic nucleotide-gated cation channel modulatory subunit,Cyclic nucleotide-ga
EIAAB08187 Canis familiaris,Canis lupus familiaris,CNG channel beta-3,CNGB3,Cone photoreceptor cGMP-gated channel subunit beta,Cyclic nucleotide-gated cation channel beta-3,Cyclic nucleotide-gated cation channel
CSB-EL005645RA Rat Cyclic nucleotide-gated cation channel alpha-4(CNGA4) ELISA kit 96T
E1998m Bovine ELISA Kit FOR Cyclic nucleotide-gated cation channel alpha-3 96T
CSB-EL005644MO Mouse Cyclic nucleotide-gated cation channel alpha-3(CNGA3) ELISA kit 96T
CSB-EL005645HU Human Cyclic nucleotide-gated cation channel alpha-4(CNGA4) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur