Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Cyclin-D1-binding protein 1 (Grap2 and cyclin-D-interacting protein) (Maternal Id-like protein) (Stage specific embryonic cDNA-8 protein) (SSEC-8)

 CCDB1_MOUSE             Reviewed;         356 AA.
Q3TVC7; Q3UMI3; Q61162; Q99JA7; Q99KG4;
18-MAR-2008, integrated into UniProtKB/Swiss-Prot.
11-OCT-2005, sequence version 1.
12-SEP-2018, entry version 94.
RecName: Full=Cyclin-D1-binding protein 1;
AltName: Full=Grap2 and cyclin-D-interacting protein;
AltName: Full=Maternal Id-like protein;
AltName: Full=Stage specific embryonic cDNA-8 protein;
Short=SSEC-8;
Name=Ccndbp1; Synonyms=Dip1, Gcip, Maid;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, AND
DEVELOPMENTAL STAGE.
STRAIN=C57BL/6 X DBA/2;
PubMed=9186056;
DOI=10.1002/(SICI)1097-0177(199706)209:2<217::AID-AJA7>3.0.CO;2-L;
Hwang S.-Y., Oh B., Fuechtbauer A., Fuechtbauer E.-M., Johnson K.R.,
Solter D., Knowles B.B.;
"Maid: a maternally transcribed novel gene encoding a potential
negative regulator of bHLH proteins in the mouse egg and zygote.";
Dev. Dyn. 209:217-226(1997).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
STRAIN=C57BL/6J, and NOD;
TISSUE=Cerebellum, Dendritic cell, Embryo, Lung, and Placenta;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=C57BL/6J;
PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
Lindblad-Toh K., Eichler E.E., Ponting C.P.;
"Lineage-specific biology revealed by a finished genome assembly of
the mouse.";
PLoS Biol. 7:E1000112-E1000112(2009).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
STRAIN=FVB/N; TISSUE=Mammary tumor;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
FUNCTION, DEVELOPMENTAL STAGE, AND INDUCTION.
PubMed=17256742; DOI=10.1002/hep.21461;
Sonnenberg-Riethmacher E., Wuestefeld T., Miehe M., Trautwein C.,
Riethmacher D.;
"Maid (GCIP) is involved in cell cycle control of hepatocytes.";
Hepatology 45:404-411(2007).
[6]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Spleen;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: May negatively regulate cell cycle progression. May act
at least in part via inhibition of the cyclin-D1/CDK4 complex,
thereby preventing phosphorylation of RB1 and blocking E2F-
dependent transcription (By similarity). May be required for
hepatocyte proliferation. {ECO:0000250,
ECO:0000269|PubMed:17256742}.
-!- SUBUNIT: Interacts with CCND1 and GRAP2. May also interact with
COPS5, RPLP0, SIRT6, SYF2 and TCF3. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus
{ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q3TVC7-1; Sequence=Displayed;
Name=2;
IsoId=Q3TVC7-2; Sequence=VSP_032017;
Name=3;
IsoId=Q3TVC7-3; Sequence=VSP_032018;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed at high levels in brain, intestine,
muscle and ovary and at lower levels in heart, kidney, liver,
lung, spleen and testis. {ECO:0000269|PubMed:9186056}.
-!- DEVELOPMENTAL STAGE: Highly expressed in the unfertilized egg.
Expression is reduced at the two cell and blastocyst stages.
Expressed in the liver, CNS and dorsal root ganglia throughout
organogenesis. Also expressed in the intestine, kidney, lung,
nasal cavities and thymus from E13. {ECO:0000269|PubMed:17256742,
ECO:0000269|PubMed:9186056}.
-!- INDUCTION: Expression is induced by partial hepatectomy.
{ECO:0000269|PubMed:17256742}.
-!- PTM: Phosphorylated. {ECO:0000250}.
-!- SIMILARITY: Belongs to the CCNDBP1 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAB58118.1; Type=Frameshift; Positions=275, 278, 286; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; U50734; AAB58118.1; ALT_FRAME; mRNA.
EMBL; AK144883; BAE26115.1; -; mRNA.
EMBL; AK154285; BAE32489.1; -; mRNA.
EMBL; AK160205; BAE35692.1; -; mRNA.
EMBL; AK163150; BAE37214.1; -; mRNA.
EMBL; AK167345; BAE39444.1; -; mRNA.
EMBL; AL844548; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC001984; AAH01984.2; -; mRNA.
EMBL; BC004673; AAH04673.1; -; mRNA.
EMBL; BC005802; AAH05802.1; -; mRNA.
CCDS; CCDS38213.1; -. [Q3TVC7-1]
RefSeq; NP_034891.2; NM_010761.2. [Q3TVC7-1]
UniGene; Mm.7838; -.
ProteinModelPortal; Q3TVC7; -.
SMR; Q3TVC7; -.
IntAct; Q3TVC7; 1.
MINT; Q3TVC7; -.
STRING; 10090.ENSMUSP00000062496; -.
PhosphoSitePlus; Q3TVC7; -.
EPD; Q3TVC7; -.
MaxQB; Q3TVC7; -.
PaxDb; Q3TVC7; -.
PeptideAtlas; Q3TVC7; -.
PRIDE; Q3TVC7; -.
Ensembl; ENSMUST00000060455; ENSMUSP00000062496; ENSMUSG00000023572. [Q3TVC7-1]
Ensembl; ENSMUST00000099489; ENSMUSP00000097088; ENSMUSG00000023572. [Q3TVC7-2]
Ensembl; ENSMUST00000171260; ENSMUSP00000125961; ENSMUSG00000023572. [Q3TVC7-3]
GeneID; 17151; -.
KEGG; mmu:17151; -.
UCSC; uc008lxg.1; mouse. [Q3TVC7-1]
CTD; 23582; -.
MGI; MGI:109595; Ccndbp1.
eggNOG; ENOG410II9T; Eukaryota.
eggNOG; ENOG410ZPHZ; LUCA.
GeneTree; ENSGT00390000018016; -.
HOGENOM; HOG000111444; -.
HOVERGEN; HBG107623; -.
InParanoid; Q3TVC7; -.
KO; K21626; -.
OMA; HCMNRIK; -.
OrthoDB; EOG091G0HT3; -.
PhylomeDB; Q3TVC7; -.
TreeFam; TF336444; -.
PRO; PR:Q3TVC7; -.
Proteomes; UP000000589; Chromosome 2.
Bgee; ENSMUSG00000023572; Expressed in 289 organ(s), highest expression level in blood.
CleanEx; MM_CCNDBP1; -.
ExpressionAtlas; Q3TVC7; baseline and differential.
Genevisible; Q3TVC7; MM.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell.
GO; GO:0005654; C:nucleoplasm; ISO:MGI.
GO; GO:0005634; C:nucleus; ISO:MGI.
GO; GO:0007049; P:cell cycle; IEA:UniProtKB-KW.
GO; GO:0051726; P:regulation of cell cycle; IEA:InterPro.
InterPro; IPR026907; CCNDBP1.
PANTHER; PTHR15492; PTHR15492; 1.
1: Evidence at protein level;
Acetylation; Alternative splicing; Cell cycle; Complete proteome;
Cytoplasm; Nucleus; Phosphoprotein; Reference proteome.
INIT_MET 1 1 Removed. {ECO:0000250|UniProtKB:O95273}.
CHAIN 2 356 Cyclin-D1-binding protein 1.
/FTId=PRO_0000323374.
REGION 2 205 Required for interaction with CCND1.
{ECO:0000250}.
REGION 2 187 Interaction with RPLP0. {ECO:0000250}.
REGION 2 181 Interaction with TCF3. {ECO:0000250}.
REGION 147 356 Interaction with TCF3. {ECO:0000250}.
REGION 236 356 Interaction with RPLP0. {ECO:0000250}.
MOD_RES 2 2 N-acetylalanine.
{ECO:0000250|UniProtKB:O95273}.
VAR_SEQ 1 47 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:9186056}.
/FTId=VSP_032017.
VAR_SEQ 304 349 SAKLVSVLIKALEITKASHVSPHPGDSWIPLLINAVDHCMN
RIKAL -> VNVWTLRGSVTLPDYPETVHSLNLELVWQQAS
PAIALPLCPQRWSNRYTHGHTSFFYVCLGLNSCPYACKHS
(in isoform 3).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_032018.
SEQUENCE 356 AA; 39356 MW; E112C12AB12B7568 CRC64;
MASSTAAVPF LAPPLEQLRH LAEELRSLLP RVRVGEAQET AEEFNREMFW RRLNEAAVKV
NGEATVLTTH FSKLPWPSPQ ETQRICEQVR IAIEEIIIVY YSLPKDQGIT LRKLVRNAAL
DIVDGMAQLL EVLLTAPSQS TENGDLISCN SVSVACQQVP EIPKDNKAAA LLMLTKSVDF
VKDAHEEMEQ AVEECDPYSG LLNDSEDNSD SHSDEDGVLG LPSNRDSYWS EEDQELIIPC
LALVRASRAS LKKIRILVAE NGKKDEVAQL DDIVDISDEI SPSVDDLVLS IYPPVCHLTV
RISSAKLVSV LIKALEITKA SHVSPHPGDS WIPLLINAVD HCMNRIKALT QRAAEL


Related products :

Catalog number Product name Quantity
EIAAB06053 Ccndbp1,Cyclin-D1-binding protein 1,Dip1,Gcip,Grap2 and cyclin-D-interacting protein,Maid,Maternal Id-like protein,Mouse,Mus musculus,SSEC-8,Stage specific embryonic cDNA-8 protein
EIAAB06056 CCNDBP1,Cyclin-D1-binding protein 1,DIP1,GCIP,Grap2 and cyclin-D-interacting protein,HHM,Homo sapiens,Human,Human homolog of Maid
EIAAB06187 C10orf9,CBCP1,CCNY,CFP1,Cyclin box protein 1,Cyclin fold protein 1,cyclin-X,Cyclin-Y,Cyc-Y,Homo sapiens,Human
EIAAB11494 Cyclin-D-binding Myb-like transcription factor 1,Cyclin-D-interacting Myb-like protein 1,Dmp1,Dmtf1,mDmp1,Mouse,Mus musculus
EIAAB11493 Cyclin-D-binding Myb-like transcription factor 1,Cyclin-D-interacting Myb-like protein 1,DMP1,DMTF1,hDMP1,hDMTF1,Homo sapiens,Human
orb80776 Human cyclin-C protein Cyclin Recombinant is expressed in E.coli as 35kDa tagged fusion protein corresponding to amino acids 120-303 of Cyclin of human origin. Cyclin is purified from bacterial lysate 2
EIAAB29754 Homo sapiens,HSPC218,Human,PABP-interacting protein 2,PAIP2,PAIP-2,PAIP2A,Poly(A)-binding protein-interacting protein 2,Polyadenylate-binding protein-interacting protein 2
EIAAB29748 Homo sapiens,Human,KIAA1155,PABP-interacting protein 2B,PAIP2B,PAIP-2B,Poly(A)-binding protein-interacting protein 2B,Polyadenylate-binding protein-interacting protein 2B
EIAAB29747 Kiaa1155,Mouse,Mus musculus,PABP-interacting protein 2B,Paip2b,PAIP-2B,Poly(A)-binding protein-interacting protein 2B,Polyadenylate-binding protein-interacting protein 2B
EIAAB29749 Homo sapiens,Human,PABP-interacting protein 1,PAIP1,PAIP-1,Poly(A)-binding protein-interacting protein 1,Polyadenylate-binding protein-interacting protein 1
EIAAB13056 Embryonic poly(A)-binding protein 2,Embryonic poly(A)-binding protein type II,Embryonic polyadenylate-binding protein 2,ePABP2,EPABP2,ePABP-2,Homo sapiens,Human,PABPN1L,PABPNL1,Poly(A)-binding protein
EIAAB29755 Mouse,Mus musculus,PABP-interacting protein 2,Paip2,PAIP-2,Poly(A)-binding protein-interacting protein 2,Polyadenylate-binding protein-interacting protein 2
EIAAB29751 PABP-interacting protein 2,Paip2,PAIP-2,Poly(A)-binding protein-interacting protein 2,Polyadenylate-binding protein-interacting protein 2,Rat,Rattus norvegicus
EIAAB29750 Mouse,Mus musculus,PABP-interacting protein 1,Paip1,PAIP-1,Poly(A)-binding protein-interacting protein 1,Polyadenylate-binding protein-interacting protein 1
EIAAB29752 Bos taurus,Bovine,PABP-interacting protein 2,PAIP2,PAIP-2,Poly(A)-binding protein-interacting protein 2,Polyadenylate-binding protein-interacting protein 2
EIAAB07414 CDK2-interacting protein,CINP,Cyclin-dependent kinase 2-interacting protein,Homo sapiens,Human
EIAAB39347 Mouse,Mus musculus,Spata24,Spermatogenesis-associated protein 24,TATA-binding protein-like factor-interacting protein,Testis protein T6441 homolog,Tipt,Tipt2,TLF-interacting protein,TRF2-interacting p
EIAAB45941 Homo sapiens,Human,hVPS35,Maternal-embryonic 3,MEM3,TCCCTA00141,Vacuolar protein sorting-associated protein 35,Vesicle protein sorting 35,VPS35
EIAAB45942 Maternal-embryonic 3,Mem3,Mouse,Mus musculus,Vacuolar protein sorting-associated protein 35,Vesicle protein sorting 35,Vps35
EIAAB13055 Embryonic poly(A)-binding protein 2,Embryonic poly(A)-binding protein type II,Embryonic polyadenylate-binding protein 2,ePABP2,Epabp2,ePABP-2,Pabpn1l,Pabpnl1,Poly(A)-binding protein nuclear-like 1,Rat
EIAAB37520 Homo sapiens,Human,KIAA1454,MSTP063,S phase cyclin A-associated protein in the endoplasmic reticulum,S phase cyclin A-associated protein in the ER,SCAPER,Zinc finger protein 291,ZNF291
18-003-43619 Polyadenylate-binding protein-interacting protein 1 - Poly(A)-binding protein-interacting protein 1; PABP-interacting protein 1; PAIP-1 Polyclonal 0.1 mg Protein A
EIAAB13057 Embryonic poly(A)-binding protein 2,Embryonic poly(A)-binding protein type II,Embryonic polyadenylate-binding protein 2,ePABP2,Epabp2,ePABP-2,Gm1108,Mouse,Mus musculus,Pabpn1l,Pabpnl1,Poly(A)-binding
EIAAB29753 Chicken,Gallus gallus,PABP-interacting protein 2,PAIP2,PAIP-2,Poly(A)-binding protein-interacting protein 2,Polyadenylate-binding protein-interacting protein 2,RCJMB04_16b5
pka-269 Recombinant Human Cyclin-Dependent Kinase 2 Interacting Protein PROTEIN KINASES 1mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur