Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Cytochrome P450 3A5 (EC 1.14.14.1) (CYPIIIA5) (Cytochrome P450 HLp2) (Cytochrome P450-PCN3)

 CP3A5_HUMAN             Reviewed;         502 AA.
P20815; A4D289; B7Z5I7; Q53WY8; Q75MV0; Q9HB56;
01-FEB-1991, integrated into UniProtKB/Swiss-Prot.
01-FEB-1991, sequence version 1.
28-MAR-2018, entry version 183.
RecName: Full=Cytochrome P450 3A5;
EC=1.14.14.1;
AltName: Full=CYPIIIA5;
AltName: Full=Cytochrome P450 HLp2;
AltName: Full=Cytochrome P450-PCN3;
Name=CYP3A5;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=2732228;
Aoyama T., Yamano S., Waxman D.J., Lapenson D.P., Meyer U.A.,
Fischer V., Tyndale R., Inaba T., Kalow W., Gelboin H.V.,
Gonzalez F.J.;
"Cytochrome P-450 hPCN3, a novel cytochrome P-450 IIIA gene product
that is differentially expressed in adult human liver. cDNA and
deduced amino acid sequence and distinct specificities of cDNA-
expressed hPCN1 and hPCN3 for the metabolism of steroid hormones and
cyclosporine.";
J. Biol. Chem. 264:10388-10395(1989).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND CHARACTERIZATION.
TISSUE=Liver;
PubMed=2802615; DOI=10.1016/0003-9861(89)90449-9;
Schuetz J.D., Molowa D.T., Guzelian P.S.;
"Characterization of a cDNA encoding a new member of the
glucocorticoid-responsive cytochromes P450 in human liver.";
Arch. Biochem. Biophys. 274:355-365(1989).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12690205; DOI=10.1126/science.1083423;
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K.,
Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R.,
Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A.,
Kanematsu E., Gentles S., Christopoulos C.C., Choufani S.,
Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z.,
Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C.,
Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J.,
Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F.,
Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F.,
Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H.,
Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G.,
Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P.,
Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J.,
Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F.,
Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B.,
Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H.,
Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W.,
Mural R.J., Adams M.D., Tsui L.-C.;
"Human chromosome 7: DNA sequence and biology.";
Science 300:767-772(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12853948; DOI=10.1038/nature01782;
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H.,
Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R.,
Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E.,
Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H.,
Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A.,
Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J.,
Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A.,
Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S.,
Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M.,
Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C.,
Latreille P., Miller N., Johnson D., Murray J., Woessner J.P.,
Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J.,
Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L.,
Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R.,
Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E.,
Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K.,
Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S.,
Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M.,
Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R.,
Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D.,
Waterston R.H., Wilson R.K.;
"The DNA sequence of human chromosome 7.";
Nature 424:157-164(2003).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Colon;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-106.
PubMed=11266076; DOI=10.1097/00008571-200103000-00002;
Gellner K., Eiselt R., Hustert E., Arnold H., Koch I., Haberl M.,
Deglmann C.J., Burk O., Buntefuss D., Escher S., Bishop C.,
Koebe H.-G., Brinkmann U., Klenk H.-P., Kleine K., Meyer U.A.,
Wojnowski L.;
"Genomic organization of the human CYP3A locus: identification of a
new, inducible CYP3A gene.";
Pharmacogenetics 11:111-121(2001).
[9]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-24.
PubMed=8569713;
Schuetz J.D., Schuetz E.G., Thottassery J.V., Guzelian P.S., Strom S.,
Sun D.;
"Identification of a novel dexamethasone responsive enhancer in the
human CYP3A5 gene and its activation in human and rat liver cells.";
Mol. Pharmacol. 49:63-72(1996).
[10]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-24.
PubMed=7811260; DOI=10.1006/bbrc.1994.2870;
Jounaidi Y., Guzelian P.S., Maurel P., Vilarem M.J.;
"Sequence of the 5'-flanking region of CYP3A5: comparative analysis
with CYP3A4 and CYP3A7.";
Biochem. Biophys. Res. Commun. 205:1741-1747(1994).
[11]
TRANS-SPLICING.
PubMed=11726664; DOI=10.1074/jbc.M109175200;
Finta C., Zaphiropoulos P.G.;
"Intergenic mRNA molecules resulting from trans-splicing.";
J. Biol. Chem. 277:5882-5890(2002).
[12]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[13]
VARIANT CYP3A5*2 ASN-398.
PubMed=8619878; DOI=10.1006/bbrc.1996.0618;
Jounaidi Y., Hyrailles V., Gervot L., Maurel P.;
"Detection of CYP3A5 allelic variant: a candidate for the polymorphic
expression of the protein?";
Biochem. Biophys. Res. Commun. 221:466-470(1996).
[14]
VARIANT CYP3A5*4 ARG-200.
PubMed=11502729;
Chou F.C., Tzeng S.J., Huang J.D.;
"Genetic polymorphism of cytochrome P450 3A5 in Chinese.";
Drug Metab. Dispos. 29:1205-1209(2001).
[15]
VARIANTS CYS-28; THR-337 AND SER-446.
PubMed=12893984; DOI=10.1097/00008571-200308000-00004;
Lee S.J., Usmani K.A., Chanas B., Ghanayem B., Xi T., Hodgson E.,
Mohrenweiser H.W., Goldstein J.A.;
"Genetic findings and functional studies of human CYP3A5 single
nucleotide polymorphisms in different ethnic groups.";
Pharmacogenetics 13:461-472(2003).
[16]
VARIANTS TYR-30; GLU-277; THR-337 AND ASN-398.
PubMed=15469410; DOI=10.1517/14622416.5.7.895;
Solus J.F., Arietta B.J., Harris J.R., Sexton D.P., Steward J.Q.,
McMunn C., Ihrie P., Mehall J.M., Edwards T.L., Dawson E.P.;
"Genetic variation in eleven phase I drug metabolism genes in an
ethnically diverse population.";
Pharmacogenomics 5:895-931(2004).
-!- FUNCTION: Cytochromes P450 are a group of heme-thiolate
monooxygenases. In liver microsomes, this enzyme is involved in an
NADPH-dependent electron transport pathway. It oxidizes a variety
of structurally unrelated compounds, including steroids, fatty
acids, and xenobiotics.
-!- CATALYTIC ACTIVITY: RH + [reduced NADPH--hemoprotein reductase] +
O(2) = ROH + [oxidized NADPH--hemoprotein reductase] + H(2)O.
-!- COFACTOR:
Name=heme; Xref=ChEBI:CHEBI:30413; Evidence={ECO:0000250};
-!- SUBCELLULAR LOCATION: Endoplasmic reticulum membrane; Peripheral
membrane protein. Microsome membrane; Peripheral membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P20815-1; Sequence=Displayed;
Name=2;
IsoId=P20815-2; Sequence=VSP_042734, VSP_042735;
Note=No experimental confirmation available.;
-!- INDUCTION: P450 can be induced to high levels in liver and other
tissues by various foreign compounds, including drugs, pesticides,
and carcinogens.
-!- MISCELLANEOUS: Chimeric transcripts, characterized by CYP3A43 exon
1 joined at canonical splice sites to distinct sets of CYP3A5
exons, have been detected. All are possibly produced by trans-
splicing. The chimeric transcripts exist in 2 different
combinations: CYP3A43 exon 1 joined in frame to CYP3A5 exon 11-13
and CYP3A43 exon 1 joined in frame to CYP3A5 exon 12-13. All
chimeric transcripts are expressed at very low levels in the liver
(PubMed:11726664). {ECO:0000305|PubMed:11726664}.
-!- SIMILARITY: Belongs to the cytochrome P450 family. {ECO:0000305}.
-!- WEB RESOURCE: Name=Cytochrome P450 Allele Nomenclature Committee;
Note=CYP3A5 alleles;
URL="http://www.cypalleles.ki.se/cyp3a5.htm";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; J04813; AAA02993.1; -; mRNA.
EMBL; AK299002; BAH12923.1; -; mRNA.
EMBL; AC005020; AAS02016.1; -; Genomic_DNA.
EMBL; CH236956; EAL23868.1; -; Genomic_DNA.
EMBL; CH471091; EAW76638.1; -; Genomic_DNA.
EMBL; CH471091; EAW76642.1; -; Genomic_DNA.
EMBL; BC033862; AAH33862.1; -; mRNA.
EMBL; AF280107; AAG32288.1; -; Genomic_DNA.
EMBL; L35912; AAB00083.1; -; Genomic_DNA.
EMBL; S74699; AAD14157.1; -; Genomic_DNA.
EMBL; S74700; AAD14158.1; -; Genomic_DNA.
CCDS; CCDS55134.1; -. [P20815-2]
CCDS; CCDS5672.1; -. [P20815-1]
PIR; A34101; A34101.
PIR; A60558; A60558.
RefSeq; NP_000768.1; NM_000777.4. [P20815-1]
RefSeq; NP_001177413.1; NM_001190484.2. [P20815-2]
UniGene; Hs.571258; -.
PDB; 5VEU; X-ray; 2.91 A; A/B/C/D/E/F/G/H/I/J/K/L=24-497.
PDBsum; 5VEU; -.
ProteinModelPortal; P20815; -.
SMR; P20815; -.
BioGrid; 107949; 7.
IntAct; P20815; 4.
STRING; 9606.ENSP00000222982; -.
BindingDB; P20815; -.
ChEMBL; CHEMBL3019; -.
DrugBank; DB00802; Alfentanil.
DrugBank; DB00404; Alprazolam.
DrugBank; DB06403; Ambrisentan.
DrugBank; DB01118; Amiodarone.
DrugBank; DB00321; Amitriptyline.
DrugBank; DB00381; Amlodipine.
DrugBank; DB00701; Amprenavir.
DrugBank; DB06605; Apixaban.
DrugBank; DB00673; Aprepitant.
DrugBank; DB00278; Argatroban.
DrugBank; DB01238; Aripiprazole.
DrugBank; DB06413; Armodafinil.
DrugBank; DB06697; Artemether.
DrugBank; DB00637; Astemizole.
DrugBank; DB01076; Atorvastatin.
DrugBank; DB06626; Axitinib.
DrugBank; DB00972; Azelastine.
DrugBank; DB04957; Azimilide.
DrugBank; DB00394; Beclomethasone dipropionate.
DrugBank; DB08873; Boceprevir.
DrugBank; DB08870; Brentuximab vedotin.
DrugBank; DB00921; Buprenorphine.
DrugBank; DB00490; Buspirone.
DrugBank; DB06772; Cabazitaxel.
DrugBank; DB00201; Caffeine.
DrugBank; DB00564; Carbamazepine.
DrugBank; DB00439; Cerivastatin.
DrugBank; DB06419; Cethromycin.
DrugBank; DB00446; Chloramphenicol.
DrugBank; DB00608; Chloroquine.
DrugBank; DB01114; Chlorphenamine.
DrugBank; DB01166; Cilostazol.
DrugBank; DB00501; Cimetidine.
DrugBank; DB00537; Ciprofloxacin.
DrugBank; DB00604; Cisapride.
DrugBank; DB01211; Clarithromycin.
DrugBank; DB00575; Clonidine.
DrugBank; DB00758; Clopidogrel.
DrugBank; DB05239; Cobimetinib.
DrugBank; DB00907; Cocaine.
DrugBank; DB00318; Codeine.
DrugBank; DB08865; Crizotinib.
DrugBank; DB00531; Cyclophosphamide.
DrugBank; DB00091; Cyclosporine.
DrugBank; DB09102; Daclatasvir.
DrugBank; DB00250; Dapsone.
DrugBank; DB01254; Dasatinib.
DrugBank; DB00694; Daunorubicin.
DrugBank; DB00705; Delavirdine.
DrugBank; DB01234; Dexamethasone.
DrugBank; DB04856; Dexloxiglumide.
DrugBank; DB00514; Dextromethorphan.
DrugBank; DB00829; Diazepam.
DrugBank; DB00343; Diltiazem.
DrugBank; DB00822; Disulfiram.
DrugBank; DB01248; Docetaxel.
DrugBank; DB08930; Dolutegravir.
DrugBank; DB01184; Domperidone.
DrugBank; DB01126; Dutasteride.
DrugBank; DB08899; Enzalutamide.
DrugBank; DB00700; Eplerenone.
DrugBank; DB00530; Erlotinib.
DrugBank; DB00783; Estradiol.
DrugBank; DB00655; Estrone.
DrugBank; DB00593; Ethosuximide.
DrugBank; DB00773; Etoposide.
DrugBank; DB01023; Felodipine.
DrugBank; DB00813; Fentanyl.
DrugBank; DB01216; Finasteride.
DrugBank; DB00196; Fluconazole.
DrugBank; DB00472; Fluoxetine.
DrugBank; DB00499; Flutamide.
DrugBank; DB00588; Fluticasone Propionate.
DrugBank; DB01095; Fluvastatin.
DrugBank; DB00176; Fluvoxamine.
DrugBank; DB00317; Gefitinib.
DrugBank; DB06730; Gestodene.
DrugBank; DB00889; Granisetron.
DrugBank; DB01218; Halofantrine.
DrugBank; DB00502; Haloperidol.
DrugBank; DB00741; Hydrocortisone.
DrugBank; DB06789; Hydroxyprogesterone caproate.
DrugBank; DB09053; Ibrutinib.
DrugBank; DB01181; Ifosfamide.
DrugBank; DB04946; Iloperidone.
DrugBank; DB00619; Imatinib.
DrugBank; DB00224; Indinavir.
DrugBank; DB00762; Irinotecan.
DrugBank; DB01167; Itraconazole.
DrugBank; DB01026; Ketoconazole.
DrugBank; DB01259; Lapatinib.
DrugBank; DB00528; Lercanidipine.
DrugBank; DB01227; Levomethadyl Acetate.
DrugBank; DB00281; Lidocaine.
DrugBank; DB00678; Losartan.
DrugBank; DB00227; Lovastatin.
DrugBank; DB00333; Methadone.
DrugBank; DB01388; Mibefradil.
DrugBank; DB00683; Midazolam.
DrugBank; DB00834; Mifepristone.
DrugBank; DB00745; Modafinil.
DrugBank; DB00688; Mycophenolate mofetil.
DrugBank; DB00731; Nateglinide.
DrugBank; DB01149; Nefazodone.
DrugBank; DB00220; Nelfinavir.
DrugBank; DB00238; Nevirapine.
DrugBank; DB00622; Nicardipine.
DrugBank; DB01115; Nifedipine.
DrugBank; DB00393; Nimodipine.
DrugBank; DB00401; Nisoldipine.
DrugBank; DB01054; Nitrendipine.
DrugBank; DB00717; Norethisterone.
DrugBank; DB01059; Norfloxacin.
DrugBank; DB00540; Nortriptyline.
DrugBank; DB00904; Ondansetron.
DrugBank; DB00842; Oxazepam.
DrugBank; DB00776; Oxcarbazepine.
DrugBank; DB01062; Oxybutynin.
DrugBank; DB00497; Oxycodone.
DrugBank; DB01229; Paclitaxel.
DrugBank; DB01267; Paliperidone.
DrugBank; DB09297; Paritaprevir.
DrugBank; DB00738; Pentamidine.
DrugBank; DB08883; Perampanel.
DrugBank; DB00780; Phenelzine.
DrugBank; DB01174; Phenobarbital.
DrugBank; DB00252; Phenytoin.
DrugBank; DB01100; Pimozide.
DrugBank; DB08901; Ponatinib.
DrugBank; DB00175; Pravastatin.
DrugBank; DB01058; Praziquantel.
DrugBank; DB00396; Progesterone.
DrugBank; DB00571; Propranolol.
DrugBank; DB01224; Quetiapine.
DrugBank; DB01103; Quinacrine.
DrugBank; DB00468; Quinine.
DrugBank; DB00863; Ranitidine.
DrugBank; DB00206; Reserpine.
DrugBank; DB01045; Rifampicin.
DrugBank; DB01201; Rifapentine.
DrugBank; DB00734; Risperidone.
DrugBank; DB00503; Ritonavir.
DrugBank; DB06228; Rivaroxaban.
DrugBank; DB06176; Romidepsin.
DrugBank; DB01098; Rosuvastatin.
DrugBank; DB00938; Salmeterol.
DrugBank; DB01232; Saquinavir.
DrugBank; DB06335; Saxagliptin.
DrugBank; DB06731; Seproxetine.
DrugBank; DB00203; Sildenafil.
DrugBank; DB00641; Simvastatin.
DrugBank; DB00877; Sirolimus.
DrugBank; DB00398; Sorafenib.
DrugBank; DB00795; Sulfasalazine.
DrugBank; DB01268; Sunitinib.
DrugBank; DB00864; Tacrolimus.
DrugBank; DB00675; Tamoxifen.
DrugBank; DB00976; Telithromycin.
DrugBank; DB06287; Temsirolimus.
DrugBank; DB00444; Teniposide.
DrugBank; DB00342; Terfenadine.
DrugBank; DB00624; Testosterone.
DrugBank; DB01041; Thalidomide.
DrugBank; DB05773; Trastuzumab emtansine.
DrugBank; DB00656; Trazodone.
DrugBank; DB00755; Tretinoin.
DrugBank; DB00897; Triazolam.
DrugBank; DB00197; Troglitazone.
DrugBank; DB01361; Troleandomycin.
DrugBank; DB06267; Udenafil.
DrugBank; DB00313; Valproic Acid.
DrugBank; DB00862; Vardenafil.
DrugBank; DB00661; Verapamil.
DrugBank; DB00541; Vincristine.
DrugBank; DB00582; Voriconazole.
DrugBank; DB09068; Vortioxetine.
DrugBank; DB00943; Zalcitabine.
DrugBank; DB00962; Zaleplon.
DrugBank; DB00246; Ziprasidone.
DrugBank; DB00425; Zolpidem.
GuidetoPHARMACOLOGY; 1338; -.
SwissLipids; SLP:000001325; -.
iPTMnet; P20815; -.
PhosphoSitePlus; P20815; -.
BioMuta; CYP3A5; -.
DMDM; 117157; -.
PaxDb; P20815; -.
PeptideAtlas; P20815; -.
PRIDE; P20815; -.
DNASU; 1577; -.
Ensembl; ENST00000222982; ENSP00000222982; ENSG00000106258. [P20815-1]
Ensembl; ENST00000439761; ENSP00000401269; ENSG00000106258. [P20815-2]
GeneID; 1577; -.
KEGG; hsa:1577; -.
UCSC; uc003urq.4; human. [P20815-1]
CTD; 1577; -.
DisGeNET; 1577; -.
EuPathDB; HostDB:ENSG00000106258.13; -.
GeneCards; CYP3A5; -.
HGNC; HGNC:2638; CYP3A5.
HPA; HPA072245; -.
MalaCards; CYP3A5; -.
MIM; 605325; gene.
neXtProt; NX_P20815; -.
OpenTargets; ENSG00000106258; -.
Orphanet; 241043; Tacrolimus dose selection.
PharmGKB; PA131; -.
eggNOG; KOG0158; Eukaryota.
eggNOG; COG2124; LUCA.
GeneTree; ENSGT00900000140779; -.
HOGENOM; HOG000082412; -.
HOVERGEN; HBG108567; -.
InParanoid; P20815; -.
KO; K17690; -.
OMA; PAIAKHI; -.
OrthoDB; EOG091G0JNC; -.
PhylomeDB; P20815; -.
TreeFam; TF105087; -.
BRENDA; 1.14.14.1; 2681.
Reactome; R-HSA-211981; Xenobiotics.
Reactome; R-HSA-5423646; Aflatoxin activation and detoxification.
SABIO-RK; P20815; -.
ChiTaRS; CYP3A5; human.
GeneWiki; CYP3A5; -.
GenomeRNAi; 1577; -.
PRO; PR:P20815; -.
Proteomes; UP000005640; Chromosome 7.
Bgee; ENSG00000106258; -.
CleanEx; HS_CYP3A5; -.
ExpressionAtlas; P20815; baseline and differential.
Genevisible; P20815; HS.
GO; GO:0005789; C:endoplasmic reticulum membrane; TAS:Reactome.
GO; GO:0043231; C:intracellular membrane-bounded organelle; TAS:ProtInc.
GO; GO:0031090; C:organelle membrane; IEA:UniProtKB-SubCell.
GO; GO:0070330; F:aromatase activity; IEA:UniProtKB-EC.
GO; GO:0101020; F:estrogen 16-alpha-hydroxylase activity; IDA:BHF-UCL.
GO; GO:0020037; F:heme binding; IEA:InterPro.
GO; GO:0005506; F:iron ion binding; IEA:InterPro.
GO; GO:0004497; F:monooxygenase activity; ISS:UniProtKB.
GO; GO:0016491; F:oxidoreductase activity; IDA:BHF-UCL.
GO; GO:0019825; F:oxygen binding; TAS:Reactome.
GO; GO:0009822; P:alkaloid catabolic process; IDA:BHF-UCL.
GO; GO:0042737; P:drug catabolic process; IDA:BHF-UCL.
GO; GO:0002933; P:lipid hydroxylation; IDA:BHF-UCL.
GO; GO:0070989; P:oxidative demethylation; IDA:BHF-UCL.
GO; GO:0008202; P:steroid metabolic process; IDA:BHF-UCL.
GO; GO:0006805; P:xenobiotic metabolic process; TAS:Reactome.
Gene3D; 1.10.630.10; -; 1.
InterPro; IPR001128; Cyt_P450.
InterPro; IPR017972; Cyt_P450_CS.
InterPro; IPR008072; Cyt_P450_E_CYP3A.
InterPro; IPR002402; Cyt_P450_E_grp-II.
InterPro; IPR036396; Cyt_P450_sf.
Pfam; PF00067; p450; 1.
PRINTS; PR00464; EP450II.
PRINTS; PR01689; EP450IICYP3A.
PRINTS; PR00385; P450.
SUPFAM; SSF48264; SSF48264; 1.
PROSITE; PS00086; CYTOCHROME_P450; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome;
Endoplasmic reticulum; Heme; Iron; Membrane; Metal-binding; Microsome;
Monooxygenase; Oxidoreductase; Polymorphism; Reference proteome.
CHAIN 1 502 Cytochrome P450 3A5.
/FTId=PRO_0000051787.
METAL 441 441 Iron (heme axial ligand).
VAR_SEQ 107 140 SLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSG -> ICA
TTSTIKMQTHSVTMWLPPAVLQSQHGVCLFL (in
isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_042734.
VAR_SEQ 141 502 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_042735.
VARIANT 28 28 R -> C (in allele CYP3A5*8;
dbSNP:rs55817950).
{ECO:0000269|PubMed:12893984}.
/FTId=VAR_024731.
VARIANT 30 30 H -> Y (in dbSNP:rs28383468).
{ECO:0000269|PubMed:15469410}.
/FTId=VAR_024728.
VARIANT 200 200 Q -> R (in allele CYP3A5*4;
dbSNP:rs56411402).
{ECO:0000269|PubMed:11502729}.
/FTId=VAR_024732.
VARIANT 277 277 D -> E (in dbSNP:rs28383477).
{ECO:0000269|PubMed:15469410}.
/FTId=VAR_024729.
VARIANT 337 337 A -> T (in allele CYP3A5*9;
dbSNP:rs28383479).
{ECO:0000269|PubMed:12893984,
ECO:0000269|PubMed:15469410}.
/FTId=VAR_024730.
VARIANT 371 371 I -> V (in dbSNP:rs28365092).
/FTId=VAR_029161.
VARIANT 398 398 T -> N (in allele CYP3A5*2;
dbSNP:rs28365083).
{ECO:0000269|PubMed:15469410,
ECO:0000269|PubMed:8619878}.
/FTId=VAR_008365.
VARIANT 446 446 F -> S (in dbSNP:rs41279854).
{ECO:0000269|PubMed:12893984}.
/FTId=VAR_024733.
VARIANT 488 488 I -> T (in dbSNP:rs28365085).
/FTId=VAR_029162.
CONFLICT 305 305 A -> P (in Ref. 2; no nucleotide entry).
{ECO:0000305}.
CONFLICT 318 318 L -> F (in Ref. 2; no nucleotide entry).
{ECO:0000305}.
CONFLICT 324 324 H -> D (in Ref. 2; no nucleotide entry).
{ECO:0000305}.
CONFLICT 377 377 C -> G (in Ref. 2; no nucleotide entry).
{ECO:0000305}.
HELIX 32 35 {ECO:0000244|PDB:5VEU}.
TURN 45 47 {ECO:0000244|PDB:5VEU}.
HELIX 50 55 {ECO:0000244|PDB:5VEU}.
HELIX 57 67 {ECO:0000244|PDB:5VEU}.
STRAND 70 76 {ECO:0000244|PDB:5VEU}.
STRAND 79 84 {ECO:0000244|PDB:5VEU}.
HELIX 87 94 {ECO:0000244|PDB:5VEU}.
TURN 95 101 {ECO:0000244|PDB:5VEU}.
HELIX 112 116 {ECO:0000244|PDB:5VEU}.
TURN 118 120 {ECO:0000244|PDB:5VEU}.
HELIX 123 133 {ECO:0000244|PDB:5VEU}.
HELIX 134 137 {ECO:0000244|PDB:5VEU}.
HELIX 139 166 {ECO:0000244|PDB:5VEU}.
HELIX 172 189 {ECO:0000244|PDB:5VEU}.
HELIX 202 207 {ECO:0000244|PDB:5VEU}.
HELIX 208 211 {ECO:0000244|PDB:5VEU}.
HELIX 218 225 {ECO:0000244|PDB:5VEU}.
HELIX 229 235 {ECO:0000244|PDB:5VEU}.
HELIX 243 262 {ECO:0000244|PDB:5VEU}.
STRAND 264 266 {ECO:0000244|PDB:5VEU}.
HELIX 271 276 {ECO:0000244|PDB:5VEU}.
HELIX 277 280 {ECO:0000244|PDB:5VEU}.
STRAND 285 287 {ECO:0000244|PDB:5VEU}.
HELIX 292 323 {ECO:0000244|PDB:5VEU}.
HELIX 325 338 {ECO:0000244|PDB:5VEU}.
HELIX 340 342 {ECO:0000244|PDB:5VEU}.
HELIX 347 352 {ECO:0000244|PDB:5VEU}.
HELIX 354 366 {ECO:0000244|PDB:5VEU}.
STRAND 369 376 {ECO:0000244|PDB:5VEU}.
STRAND 381 388 {ECO:0000244|PDB:5VEU}.
STRAND 393 396 {ECO:0000244|PDB:5VEU}.
HELIX 398 402 {ECO:0000244|PDB:5VEU}.
TURN 405 407 {ECO:0000244|PDB:5VEU}.
STRAND 408 410 {ECO:0000244|PDB:5VEU}.
HELIX 416 418 {ECO:0000244|PDB:5VEU}.
STRAND 424 426 {ECO:0000244|PDB:5VEU}.
TURN 428 430 {ECO:0000244|PDB:5VEU}.
HELIX 444 459 {ECO:0000244|PDB:5VEU}.
STRAND 462 465 {ECO:0000244|PDB:5VEU}.
STRAND 478 481 {ECO:0000244|PDB:5VEU}.
STRAND 484 486 {ECO:0000244|PDB:5VEU}.
STRAND 489 494 {ECO:0000244|PDB:5VEU}.
SEQUENCE 502 AA; 57109 MW; D5A2302E2633E717 CRC64;
MDLIPNLAVE TWLLLAVSLV LLYLYGTRTH GLFKRLGIPG PTPLPLLGNV LSYRQGLWKF
DTECYKKYGK MWGTYEGQLP VLAITDPDVI RTVLVKECYS VFTNRRSLGP VGFMKSAISL
AEDEEWKRIR SLLSPTFTSG KLKEMFPIIA QYGDVLVRNL RREAEKGKPV TLKDIFGAYS
MDVITGTSFG VNIDSLNNPQ DPFVESTKKF LKFGFLDPLF LSIILFPFLT PVFEALNVSL
FPKDTINFLS KSVNRMKKSR LNDKQKHRLD FLQLMIDSQN SKETESHKAL SDLELAAQSI
IFIFAGYETT SSVLSFTLYE LATHPDVQQK LQKEIDAVLP NKAPPTYDAV VQMEYLDMVV
NETLRLFPVA IRLERTCKKD VEINGVFIPK GSMVVIPTYA LHHDPKYWTE PEEFRPERFS
KKKDSIDPYI YTPFGTGPRN CIGMRFALMN MKLALIRVLQ NFSFKPCKET QIPLKLDTQG
LLQPEKPIVL KVDSRDGTLS GE


Related products :

Catalog number Product name Quantity
EIAAB08975 CYP3A5,CYPIIIA5,Cytochrome P450 3A5,Cytochrome P450 HLp2,Cytochrome P450-PCN3,Homo sapiens,Human
EIAAB08920 CYP2C8,CYPIIC8,Cytochrome P450 2C8,Cytochrome P450 form 1,Cytochrome P450 IIC2,Cytochrome P450 MP-12,Cytochrome P450 MP-20,Homo sapiens,Human,S-mephenytoin 4-hydroxylase
EIAAB08901 Cyp2b1,Cyp2b-1,CYPIIB1,Cytochrome P450 2B1,Cytochrome P450b,Cytochrome P450-B,Cytochrome P450-LM2,Cytochrome P450-PB1,Cytochrome P450-PB2,Rat,Rattus norvegicus
E1557h ELISA 21-OHase,CYP21,CYP21A2,CYP21B,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Cytochrome P450-C21B,Homo sapiens,Human,Steroid 21-hydroxylase 96T
U1557h CLIA 21-OHase,CYP21,CYP21A2,CYP21B,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Cytochrome P450-C21B,Homo sapiens,Human,Steroid 21-hydroxylase 96T
E1557h ELISA kit 21-OHase,CYP21,CYP21A2,CYP21B,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Cytochrome P450-C21B,Homo sapiens,Human,Steroid 21-hydroxylase 96T
EIAAB08923 Cyp2c12,Cyp2c-12,Cyp2c40,CYPIIC12,Cytochrome P450 15-beta,Cytochrome P450 2C12, female-specific,Cytochrome P450I,Cytochrome P450-UT-1,Cytochrome P450-UT-I,Rat,Rattus norvegicus
EIAAB08974 Albendazole monooxygenase,Albendazole sulfoxidase,CYP3A3,CYP3A4,CYPIIIA3,CYPIIIA4,Cytochrome P450 3A3,Cytochrome P450 3A4,Cytochrome P450 HLp,Cytochrome P450 NF-25,Cytochrome P450-PCN1,Homo sapiens,Hu
U0988Rb CLIA 4-nitrophenol 2-hydroxylase,CYP2E,CYP2E1,CYPIIE1,Cytochrome P450 2E1,Cytochrome P450 isozyme 3A,Cytochrome P450 LM3A,Cytochrome P450-ALC,Oryctolagus cuniculus,Rabbit 96T
E0988Rb ELISA 4-nitrophenol 2-hydroxylase,CYP2E,CYP2E1,CYPIIE1,Cytochrome P450 2E1,Cytochrome P450 isozyme 3A,Cytochrome P450 LM3A,Cytochrome P450-ALC,Oryctolagus cuniculus,Rabbit 96T
E0988Rb ELISA kit 4-nitrophenol 2-hydroxylase,CYP2E,CYP2E1,CYPIIE1,Cytochrome P450 2E1,Cytochrome P450 isozyme 3A,Cytochrome P450 LM3A,Cytochrome P450-ALC,Oryctolagus cuniculus,Rabbit 96T
EIAAB08934 Cyp2d1,Cyp2d-1,Cyp2d9,CYPIID1,Cytochrome P450 2D1,Cytochrome P450-CMF1A,Cytochrome P450-DB1,Cytochrome P450-UT-7,Debrisoquine 4-hydroxylase,Rat,Rattus norvegicus
EIAAB08904 CYP2B4,CYPIIB4,Cytochrome P450 2B4,Cytochrome P450 isozyme 2,Cytochrome P450 LM2,Cytochrome P450 type B0,Cytochrome P450 type B1,Oryctolagus cuniculus,Rabbit
EIAAB08908 Cyp2b10,Cyp2b-10,Cyp2b20,CYPIIB10,CYPIIB20,Cytochrome P450 2B10,Cytochrome P450 2B20,Cytochrome P450 clone PF3_46,Cytochrome P450-16-alpha,Mouse,Mus musculus,P24,Testosterone 16-alpha hydroxylase
EIAAB08843 CYP1A1,CYPIA1,Cytochrome P450 1A1,Cytochrome P450 form 6,Cytochrome P450-C,Cytochrome P450-P1,Homo sapiens,Human
EIAAB08847 CYP1A2,CYPIA2,Cytochrome P450 1A2,Cytochrome P450 isozyme 4,Cytochrome P450 LM4,Cytochrome P450-PM4,Oryctolagus cuniculus,Rabbit
E1557m ELISA kit 21-OHase,Cyp21,Cyp21a1,Cyp21a-1,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Mouse,Mus musculus,Steroid 21-hydroxylase 96T
E1557m ELISA 21-OHase,Cyp21,Cyp21a1,Cyp21a-1,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Mouse,Mus musculus,Steroid 21-hydroxylase 96T
U1557m CLIA 21-OHase,Cyp21,Cyp21a1,Cyp21a-1,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Mouse,Mus musculus,Steroid 21-hydroxylase 96T
E1557p ELISA 21-OHase,CYP21,CYP21A1,CYP21A3,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Pig,Steroid 21-hydroxylase,Sus scrofa 96T
E1557r ELISA kit 21-OHase,Cyp21,Cyp21a1,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Rat,Rattus norvegicus,Steroid 21-hydroxylase 96T
U1557p CLIA 21-OHase,CYP21,CYP21A1,CYP21A3,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Pig,Steroid 21-hydroxylase,Sus scrofa 96T
U1557r CLIA 21-OHase,Cyp21,Cyp21a1,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Rat,Rattus norvegicus,Steroid 21-hydroxylase 96T
E1557p ELISA kit 21-OHase,CYP21,CYP21A1,CYP21A3,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Pig,Steroid 21-hydroxylase,Sus scrofa 96T
E1557b ELISA 21-OHase,Bos taurus,Bovine,CYP21,CYP21A1,Cytochrome P450 21,Cytochrome P450 XXI,Cytochrome P-450c21,Cytochrome P450-C21,Steroid 21-hydroxylase 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur