Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Dehydrodolichyl diphosphate synthase complex subunit DHDDS (EC 2.5.1.87) (Cis-isoprenyltransferase) (CIT) (Cis-IPTase) (Epididymis tissue protein Li 189m)

 DHDDS_HUMAN             Reviewed;         333 AA.
Q86SQ9; B7Z4B9; B7ZB20; D3DPK7; D3DPK8; D3DPK9; E9KL43; Q5T0A4;
Q8NE90; Q9BTG5; Q9BTK3; Q9H905;
13-APR-2004, integrated into UniProtKB/Swiss-Prot.
17-OCT-2006, sequence version 3.
10-OCT-2018, entry version 143.
RecName: Full=Dehydrodolichyl diphosphate synthase complex subunit DHDDS {ECO:0000305};
EC=2.5.1.87 {ECO:0000269|PubMed:25066056, ECO:0000269|PubMed:28842490};
AltName: Full=Cis-isoprenyltransferase {ECO:0000303|PubMed:14652022};
Short=CIT {ECO:0000303|PubMed:28842490};
Short=Cis-IPTase {ECO:0000303|PubMed:14652022};
AltName: Full=Cis-prenyltransferase subunit hCIT {ECO:0000303|PubMed:28842490};
AltName: Full=Epididymis tissue protein Li 189m;
Name=DHDDS {ECO:0000303|PubMed:21295283, ECO:0000312|HGNC:HGNC:20603};
Synonyms=HDS;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Testis;
PubMed=12591616; DOI=10.1016/S0167-4781(02)00628-0;
Endo S., Zhang Y.-W., Takahashi S., Koyama T.;
"Identification of human dehydrodolichyl diphosphate synthase gene.";
Biochim. Biophys. Acta 1625:291-295(2003).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-253, AND TISSUE
SPECIFICITY.
TISSUE=Epididymis;
PubMed=20736409; DOI=10.1074/mcp.M110.001719;
Li J., Liu F., Wang H., Liu X., Liu J., Li N., Wan F., Wang W.,
Zhang C., Jin S., Liu J., Zhu P., Liu Y.;
"Systematic mapping and functional analysis of a family of human
epididymal secretory sperm-located proteins.";
Mol. Cell. Proteomics 9:2517-2528(2010).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), AND VARIANT
MET-253.
TISSUE=Teratocarcinoma, and Thyroid;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), AND VARIANT
MET-253.
TISSUE=Lung, Muscle, and Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=14652022; DOI=10.1016/j.bbrc.2003.11.065;
Shridas P., Rush J.S., Waechter C.J.;
"Identification and characterization of a cDNA encoding a long-chain
cis-isoprenyltransferase involved in dolichyl monophosphate
biosynthesis in the ER of brain cells.";
Biochem. Biophys. Res. Commun. 312:1349-1356(2003).
[8]
INTERACTION WITH NUS1.
PubMed=21572394; DOI=10.1038/emboj.2011.147;
Harrison K.D., Park E.J., Gao N., Kuo A., Rush J.S., Waechter C.J.,
Lehrman M.A., Sessa W.C.;
"Nogo-B receptor is necessary for cellular dolichol biosynthesis and
protein N-glycosylation.";
EMBO J. 30:2490-2500(2011).
[9]
CATALYTIC ACTIVITY, FUNCTION, SUBUNIT, AND PATHWAY.
PubMed=25066056; DOI=10.1016/j.cmet.2014.06.016;
Park E.J., Grabinska K.A., Guan Z., Stranecky V., Hartmannova H.,
Hodanova K., Baresova V., Sovova J., Jozsef L., Ondruskova N.,
Hansikova H., Honzik T., Zeman J., Hulkova H., Wen R., Kmoch S.,
Sessa W.C.;
"Mutation of Nogo-B receptor, a subunit of cis-prenyltransferase,
causes a congenital disorder of glycosylation.";
Cell Metab. 20:448-457(2014).
[10]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25944712; DOI=10.1002/pmic.201400617;
Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M.,
Ayoub D., Lane L., Bairoch A., Van Dorsselaer A., Carapito C.;
"N-terminome analysis of the human mitochondrial proteome.";
Proteomics 15:2519-2524(2015).
[11]
COFACTOR, SUBUNIT, CATALYTIC ACTIVITY, FUNCTION, CHARACTERIZATION OF
VARIANT GLU-42, BIOPHYSICOCHEMICAL PROPERTIES, PATHWAY, AND ACTIVITY
REGULATION.
PubMed=28842490; DOI=10.1074/jbc.M117.806034;
Grabinska K.A., Edani B.H., Park E.J., Kraehling J.R., Sessa W.C.;
"A conserved C-terminal RXG motif in the NgBR subunit of cis-
prenyltransferase is critical for prenyltransferase activity.";
J. Biol. Chem. 292:17351-17361(2017).
[12]
VARIANT RP59 GLU-42.
PubMed=21295283; DOI=10.1016/j.ajhg.2011.01.001;
Zuchner S., Dallman J., Wen R., Beecham G., Naj A., Farooq A.,
Kohli M.A., Whitehead P.L., Hulme W., Konidari I., Edwards Y.J.,
Cai G., Peter I., Seo D., Buxbaum J.D., Haines J.L., Blanton S.,
Young J., Alfonso E., Vance J.M., Lam B.L., Pericak-Vance M.A.;
"Whole-exome sequencing links a variant in DHDDS to retinitis
pigmentosa.";
Am. J. Hum. Genet. 88:201-206(2011).
[13]
INVOLVEMENT IN DEDSM, AND VARIANTS DEDSM HIS-37 AND GLN-211.
PubMed=29100083; DOI=10.1016/j.ajhg.2017.09.008;
Deciphering Developmental Disorders Study;
Hamdan F.F., Myers C.T., Cossette P., Lemay P., Spiegelman D.,
Laporte A.D., Nassif C., Diallo O., Monlong J., Cadieux-Dion M.,
Dobrzeniecka S., Meloche C., Retterer K., Cho M.T., Rosenfeld J.A.,
Bi W., Massicotte C., Miguet M., Brunga L., Regan B.M., Mo K., Tam C.,
Schneider A., Hollingsworth G., FitzPatrick D.R., Donaldson A.,
Canham N., Blair E., Kerr B., Fry A.E., Thomas R.H., Shelagh J.,
Hurst J.A., Brittain H., Blyth M., Lebel R.R., Gerkes E.H.,
Davis-Keppen L., Stein Q., Chung W.K., Dorison S.J., Benke P.J.,
Fassi E., Corsten-Janssen N., Kamsteeg E.J., Mau-Them F.T.,
Bruel A.L., Verloes A., Ounap K., Wojcik M.H., Albert D.V.F.,
Venkateswaran S., Ware T., Jones D., Liu Y.C., Mohammad S.S.,
Bizargity P., Bacino C.A., Leuzzi V., Martinelli S., Dallapiccola B.,
Tartaglia M., Blumkin L., Wierenga K.J., Purcarin G., O'Byrne J.J.,
Stockler S., Lehman A., Keren B., Nougues M.C., Mignot C., Auvin S.,
Nava C., Hiatt S.M., Bebin M., Shao Y., Scaglia F., Lalani S.R.,
Frye R.E., Jarjour I.T., Jacques S., Boucher R.M., Riou E., Srour M.,
Carmant L., Lortie A., Major P., Diadori P., Dubeau F., D'Anjou G.,
Bourque G., Berkovic S.F., Sadleir L.G., Campeau P.M., Kibar Z.,
Lafreniere R.G., Girard S.L., Mercimek-Mahmutoglu S., Boelman C.,
Rouleau G.A., Scheffer I.E., Mefford H.C., Andrade D.M., Rossignol E.,
Minassian B.A., Michaud J.L.;
"High rate of recurrent de novo mutations in developmental and
epileptic encephalopathies.";
Am. J. Hum. Genet. 101:664-685(2017).
-!- FUNCTION: With NUS1, forms the dehydrodolichyl diphosphate
synthase (DDS) complex, an essential component of the dolichol
monophosphate (Dol-P) biosynthetic machinery. Both subunits
contribute to enzymatic activity, i.e. condensation of multiple
copies of isopentenyl pyrophosphate (IPP) to farnesyl
pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-
PP), a precursor of dolichol phosphate which is utilized as a
sugar carrier in protein glycosylation in the endoplasmic
reticulum (ER) (PubMed:25066056, PubMed:28842490). Regulates the
glycosylation and stability of nascent NPC2, thereby promoting
trafficking of LDL-derived cholesterol (PubMed:21572394).
{ECO:0000269|PubMed:21572394, ECO:0000269|PubMed:25066056,
ECO:0000269|PubMed:28842490}.
-!- CATALYTIC ACTIVITY: (2E,6E)-farnesyl diphosphate + n isopentenyl
diphosphate = n diphosphate + ditrans,polycis-polyprenyl
diphosphate (n = 10-55). {ECO:0000269|PubMed:25066056,
ECO:0000269|PubMed:28842490}.
-!- COFACTOR:
Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
Evidence={ECO:0000269|PubMed:28842490};
-!- ACTIVITY REGULATION: Activated by phospholipids including
cardiolipin, phosphatidylcholine, phosphatidylethanolamine,
phosphatidylinositol and phosphatidylserine.
{ECO:0000269|PubMed:28842490}.
-!- BIOPHYSICOCHEMICAL PROPERTIES:
Kinetic parameters:
KM=11.1 uM for isopentenyl diphosphate
{ECO:0000269|PubMed:28842490};
KM=0.68 uM for (2E,6E)-farnesyl diphosphate
{ECO:0000269|PubMed:28842490};
Note=Values were measured with the heterodimer. kcat is 0.58
sec(-1) with (2E,6E)-farnesyl diphosphate and isopentenyl
diphosphate as substrate. {ECO:0000269|PubMed:28842490};
pH dependence:
Optimum pH is 8-9. Active from pH 5.5 to 9.3.
{ECO:0000269|PubMed:28842490};
-!- PATHWAY: Protein modification; protein glycosylation.
{ECO:0000269|PubMed:25066056}.
-!- PATHWAY: Lipid metabolism. {ECO:0000269|PubMed:28842490}.
-!- SUBUNIT: Forms an active dehydrodolichyl diphosphate synthase
complex with NUS1 (PubMed:25066056, PubMed:28842490). Interacts
with NPC2 (PubMed:21572394). {ECO:0000269|PubMed:21572394,
ECO:0000269|PubMed:25066056, ECO:0000269|PubMed:28842490}.
-!- SUBCELLULAR LOCATION: Endoplasmic reticulum membrane
{ECO:0000269|PubMed:14652022}; Peripheral membrane protein
{ECO:0000269|PubMed:14652022}. Note=colocalizes with calnexin.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q86SQ9-1; Sequence=Displayed;
Name=2;
IsoId=Q86SQ9-2; Sequence=VSP_010031;
Name=3;
IsoId=Q86SQ9-3; Sequence=VSP_010030;
Note=May be due to exon skipping.;
Name=4;
IsoId=Q86SQ9-4; Sequence=VSP_045007;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed at high levels in testis and kidney.
Expressed in epididymis (at protein level). Slightly expressed in
heart, spleen and thymus. {ECO:0000269|PubMed:20736409}.
-!- DISEASE: Retinitis pigmentosa 59 (RP59) [MIM:613861]: A retinal
dystrophy belonging to the group of pigmentary retinopathies.
Retinitis pigmentosa is characterized by retinal pigment deposits
visible on fundus examination and primary loss of rod
photoreceptor cells followed by secondary loss of cone
photoreceptors. Patients typically have night vision blindness and
loss of midperipheral visual field. As their condition progresses,
they lose their far peripheral visual field and eventually central
vision as well. {ECO:0000269|PubMed:21295283}. Note=The disease is
caused by mutations affecting the gene represented in this entry.
-!- DISEASE: Developmental delay and seizures with or without movement
abnormalities (DEDSM) [MIM:617836]: An autosomal dominant
neurodevelopmental disorder characterized by global developmental
delay, variable intellectual disability, and early-onset seizures
with a myoclonic component. Most patients have delayed motor
development and show abnormal movements, including ataxia,
dystonia, and tremor. {ECO:0000269|PubMed:29100083}. Note=The
disease may be caused by mutations affecting the gene represented
in this entry.
-!- SIMILARITY: Belongs to the UPP synthase family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AB090852; BAC57588.1; -; mRNA.
EMBL; GU727641; ADU87642.1; -; mRNA.
EMBL; AK023164; BAB14439.1; -; mRNA.
EMBL; AK297134; BAH12505.1; -; mRNA.
EMBL; AK316485; BAH14856.1; -; mRNA.
EMBL; AL513365; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471059; EAX07806.1; -; Genomic_DNA.
EMBL; CH471059; EAX07808.1; -; Genomic_DNA.
EMBL; CH471059; EAX07809.1; -; Genomic_DNA.
EMBL; CH471059; EAX07810.1; -; Genomic_DNA.
EMBL; CH471059; EAX07811.1; -; Genomic_DNA.
EMBL; CH471059; EAX07812.1; -; Genomic_DNA.
EMBL; BC003643; AAH03643.1; -; mRNA.
EMBL; BC004117; AAH04117.1; -; mRNA.
EMBL; BC034152; AAH34152.1; -; mRNA.
CCDS; CCDS281.1; -. [Q86SQ9-2]
CCDS; CCDS282.1; -. [Q86SQ9-1]
CCDS; CCDS57983.1; -. [Q86SQ9-4]
CCDS; CCDS57984.1; -. [Q86SQ9-3]
RefSeq; NP_001230493.1; NM_001243564.1. [Q86SQ9-4]
RefSeq; NP_001230494.1; NM_001243565.1. [Q86SQ9-3]
RefSeq; NP_079163.2; NM_024887.3. [Q86SQ9-2]
RefSeq; NP_995583.1; NM_205861.2. [Q86SQ9-1]
RefSeq; XP_006710975.1; XM_006710912.2.
RefSeq; XP_006710976.1; XM_006710913.2.
RefSeq; XP_006710977.1; XM_006710914.2.
RefSeq; XP_011540485.1; XM_011542183.2.
RefSeq; XP_011540486.1; XM_011542184.2.
RefSeq; XP_011540488.1; XM_011542186.2.
RefSeq; XP_016857868.1; XM_017002379.1.
RefSeq; XP_016857869.1; XM_017002380.1.
UniGene; Hs.369385; -.
ProteinModelPortal; Q86SQ9; -.
SMR; Q86SQ9; -.
BioGrid; 123018; 6.
CORUM; Q86SQ9; -.
STRING; 9606.ENSP00000353104; -.
iPTMnet; Q86SQ9; -.
PhosphoSitePlus; Q86SQ9; -.
BioMuta; DHDDS; -.
DMDM; 116241329; -.
EPD; Q86SQ9; -.
MaxQB; Q86SQ9; -.
PaxDb; Q86SQ9; -.
PeptideAtlas; Q86SQ9; -.
PRIDE; Q86SQ9; -.
ProteomicsDB; 69620; -.
ProteomicsDB; 69621; -. [Q86SQ9-2]
ProteomicsDB; 69622; -. [Q86SQ9-3]
DNASU; 79947; -.
Ensembl; ENST00000236342; ENSP00000236342; ENSG00000117682. [Q86SQ9-1]
Ensembl; ENST00000360009; ENSP00000353104; ENSG00000117682. [Q86SQ9-2]
Ensembl; ENST00000525682; ENSP00000434984; ENSG00000117682. [Q86SQ9-4]
Ensembl; ENST00000526219; ENSP00000434219; ENSG00000117682. [Q86SQ9-3]
GeneID; 79947; -.
KEGG; hsa:79947; -.
UCSC; uc001bmk.4; human. [Q86SQ9-1]
CTD; 79947; -.
DisGeNET; 79947; -.
EuPathDB; HostDB:ENSG00000117682.16; -.
GeneCards; DHDDS; -.
GeneReviews; DHDDS; -.
HGNC; HGNC:20603; DHDDS.
HPA; HPA026721; -.
HPA; HPA026727; -.
MalaCards; DHDDS; -.
MIM; 608172; gene.
MIM; 613861; phenotype.
MIM; 617836; phenotype.
neXtProt; NX_Q86SQ9; -.
OpenTargets; ENSG00000117682; -.
Orphanet; 791; Retinitis pigmentosa.
PharmGKB; PA134867119; -.
eggNOG; KOG1602; Eukaryota.
eggNOG; COG0020; LUCA.
GeneTree; ENSGT00390000007879; -.
HOVERGEN; HBG051350; -.
InParanoid; Q86SQ9; -.
KO; K11778; -.
OMA; FDRRDLW; -.
OrthoDB; EOG091G0K4O; -.
PhylomeDB; Q86SQ9; -.
TreeFam; TF323753; -.
BRENDA; 2.5.1.87; 2681.
Reactome; R-HSA-446199; Synthesis of Dolichyl-phosphate.
Reactome; R-HSA-4755609; Defective DHDDS causes retinitis pigmentosa 59.
UniPathway; UPA00378; -.
ChiTaRS; DHDDS; human.
GeneWiki; Dehydrodolichyl_diphosphate_synthase; -.
GeneWiki; DHDDS; -.
GenomeRNAi; 79947; -.
PRO; PR:Q86SQ9; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000117682; Expressed in 198 organ(s), highest expression level in right hemisphere of cerebellum.
CleanEx; HS_DHDDS; -.
ExpressionAtlas; Q86SQ9; baseline and differential.
Genevisible; Q86SQ9; HS.
GO; GO:1904423; C:dehydrodolichyl diphosphate synthase complex; IDA:UniProtKB.
GO; GO:0005789; C:endoplasmic reticulum membrane; TAS:Reactome.
GO; GO:0045547; F:dehydrodolichyl diphosphate synthase activity; IDA:UniProtKB.
GO; GO:0006489; P:dolichyl diphosphate biosynthetic process; IDA:UniProtKB.
GO; GO:0016094; P:polyprenol biosynthetic process; IBA:GO_Central.
CDD; cd00475; Cis_IPPS; 1.
Gene3D; 3.40.1180.10; -; 1.
HAMAP; MF_01139; ISPT; 1.
InterPro; IPR001441; UPP_synth-like.
InterPro; IPR018520; UPP_synth-like_CS.
InterPro; IPR036424; UPP_synth-like_sf.
PANTHER; PTHR10291; PTHR10291; 1.
Pfam; PF01255; Prenyltransf; 1.
SUPFAM; SSF64005; SSF64005; 1.
TIGRFAMs; TIGR00055; uppS; 1.
PROSITE; PS01066; UPP_SYNTHASE; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Disease mutation;
Endoplasmic reticulum; Epilepsy; Lipid metabolism; Magnesium;
Membrane; Mental retardation; Polymorphism; Reference proteome;
Retinitis pigmentosa; Transferase.
CHAIN 1 333 Dehydrodolichyl diphosphate synthase
complex subunit DHDDS.
/FTId=PRO_0000123749.
VAR_SEQ 109 147 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_010030.
VAR_SEQ 147 181 KCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPS -> N
(in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_045007.
VAR_SEQ 255 255 Q -> QQ (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_010031.
VARIANT 37 37 R -> H (in DEDSM; unknown pathological
significance).
{ECO:0000269|PubMed:29100083}.
/FTId=VAR_080708.
VARIANT 42 42 K -> E (in RP59; 5-fold reduction in
catalytic activity and reduced affinity
for FPP but not for IPP.;
dbSNP:rs147394623).
{ECO:0000269|PubMed:21295283,
ECO:0000269|PubMed:28842490}.
/FTId=VAR_065356.
VARIANT 211 211 R -> Q (in DEDSM; unknown pathological
significance).
{ECO:0000269|PubMed:29100083}.
/FTId=VAR_080709.
VARIANT 253 253 V -> M (in dbSNP:rs3816539).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:20736409}.
/FTId=VAR_028088.
CONFLICT 151 151 N -> Y (in Ref. 3; BAB14439).
{ECO:0000305}.
CONFLICT 277 277 V -> E (in Ref. 6; AAH34152).
{ECO:0000305}.
SEQUENCE 333 AA; 38657 MW; 12EF3A15437A2583 CRC64;
MSWIKEGELS LWERFCANII KAGPMPKHIA FIMDGNRRYA KKCQVERQEG HSQGFNKLAE
TLRWCLNLGI LEVTVYAFSI ENFKRSKSEV DGLMDLARQK FSRLMEEKEK LQKHGVCIRV
LGDLHLLPLD LQELIAQAVQ ATKNYNKCFL NVCFAYTSRH EISNAVREMA WGVEQGLLDP
SDISESLLDK CLYTNRSPHP DILIRTSGEV RLSDFLLWQT SHSCLVFQPV LWPEYTFWNL
FEAILQFQMN HSVLQKARDM YAEERKRQQL ERDQATVTEQ LLREGLQASG DAQLRRTRLH
KLSARREERV QGFLQALELK RADWLARLGT ASA


Related products :

Catalog number Product name Quantity
ARP48925_P050 DHDDS(dehydrodolichyl diphosphate synthase) 50 µg
EIAAB11129 Dedol-PP synthase,Dehydrodolichyl diphosphate synthase,Dhdds,Mouse,Mus musculus
EIAAB11128 Dedol-PP synthase,Dehydrodolichyl diphosphate synthase,DHDDS,HDS,Homo sapiens,Human
DHDPSL DHDDS Gene dehydrodolichyl diphosphate synthase
CSB-EL006845MO Mouse Dehydrodolichyl diphosphate synthase(DHDDS) ELISA kit 96T
CSB-EL006845HU Human Dehydrodolichyl diphosphate synthase(DHDDS) ELISA kit 96T
CSB-EL006845MO Mouse Dehydrodolichyl diphosphate synthase(DHDDS) ELISA kit SpeciesMouse 96T
CSB-EL006845HU Human Dehydrodolichyl diphosphate synthase(DHDDS) ELISA kit SpeciesHuman 96T
DHDDS_MOUSE ELISA Kit FOR Dehydrodolichyl diphosphate synthase; organism: Mouse; gene name: Dhdds 96T
DHDDS_HUMAN ELISA Kit FOR Dehydrodolichyl diphosphate synthase; organism: Human; gene name: DHDDS 96T
CSB-EL006845MO Mouse dehydrodolichyl diphosphate synthase (DHDDS) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL006845HU Human dehydrodolichyl diphosphate synthase (DHDDS) ELISA kit, Species Human, Sample Type serum, plasma 96T
EIAAB11424 All-trans-decaprenyl-diphosphate synthase subunit 2,Decaprenyl pyrophosphate synthase subunit 2,Decaprenyl-diphosphate synthase subunit 2,Dlp1,Mouse,Mus musculus,Pdss2,Solanesyl-diphosphate synthase s
EIAAB11864 All-trans-decaprenyl-diphosphate synthase subunit 1,Decaprenyl pyrophosphate synthase subunit 1,Decaprenyl-diphosphate synthase subunit 1,Dps1,Mouse,Mus musculus,Pdss1,Solanesyl-diphosphate synthase s
EIAAB11423 All-trans-decaprenyl-diphosphate synthase subunit 2,C6orf210,Candidate tumor suppressor protein,Decaprenyl pyrophosphate synthase subunit 2,Decaprenyl-diphosphate synthase subunit 2,DLP1,Homo sapiens,
E10808h Human Dehydrodolichyl Diphosphate Synthase ELISA K 96T
NBL1-09859 Dehydrodolichyl Diphosphate Synthase Lysate 0.1 mg
EIAAB11422 All-trans-decaprenyl-diphosphate synthase subunit 2,Decaprenyl pyrophosphate synthase subunit 2,Decaprenyl-diphosphate synthase subunit 2,Dlp1,Pdss2,Rat,Rattus norvegicus
EIAAB11863 All-trans-decaprenyl-diphosphate synthase subunit 1,Decaprenyl pyrophosphate synthase subunit 1,Decaprenyl-diphosphate synthase subunit 1,DPS1,Homo sapiens,Human,PDSS1,TPRT,TPT 1,Trans-prenyltransfera
YF-PA20969 Rabbit polyclonal to Anti-Dehydrodolichyl Diphosphate Synthase, Host Rabbit 100 uL
YF-PA20968 Mouse polyclonal to Anti-Dehydrodolichyl Diphosphate Synthase, Host Mouse 50 ug
YF-PA20967 Mouse polyclonal to Anti-Dehydrodolichyl Diphosphate Synthase, Host Mouse 50 uL
YF-PA20969 anti-anti-Dehydrodolichyl Diphosphate Synthase type: Primary antibodies host: Rabbit 100 ul
YF-PA20967 anti-anti-Dehydrodolichyl Diphosphate Synthase type: Primary antibodies host: Mouse 50 ul
26-361 Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several 0.05 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur