Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Dynamin-2 (EC 3.6.5.5)

 DYN2_RAT                Reviewed;         870 AA.
P39052;
01-FEB-1995, integrated into UniProtKB/Swiss-Prot.
01-FEB-1995, sequence version 1.
23-MAY-2018, entry version 167.
RecName: Full=Dynamin-2;
EC=3.6.5.5;
Name=Dnm2; Synonyms=Dyn2;
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
TISSUE=Brain;
PubMed=8308025;
Sontag J.-M., Fykse E.M., Ushkaryov Y., Liu J.-P., Robinson P.J.,
Suedhof T.C.;
"Differential expression and regulation of multiple dynamins.";
J. Biol. Chem. 269:4547-4554(1994).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
STRAIN=Sprague-Dawley;
PubMed=8290576; DOI=10.1073/pnas.91.2.644;
Cook T.A., Urrutia R., McNiven M.A.;
"Identification of dynamin 2, an isoform ubiquitously expressed in rat
tissues.";
Proc. Natl. Acad. Sci. U.S.A. 91:644-648(1994).
[3]
ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=9725914; DOI=10.1091/mbc.9.9.2595;
Cao H., Garcia F., McNiven M.A.;
"Differential distribution of dynamin isoforms in mammalian cells.";
Mol. Biol. Cell 9:2595-2609(1998).
[4]
INTERACTION WITH SH3BP4.
PubMed=16325581; DOI=10.1016/j.cell.2005.10.021;
Tosoni D., Puri C., Confalonieri S., Salcini A.E., De Camilli P.,
Tacchetti C., Di Fiore P.P.;
"TTP specifically regulates the internalization of the transferrin
receptor.";
Cell 123:875-888(2005).
[5]
INTERACTION WITH MYO1E.
PubMed=17257598; DOI=10.1016/j.febslet.2007.01.021;
Krendel M., Osterweil E.K., Mooseker M.S.;
"Myosin 1E interacts with synaptojanin-1 and dynamin and is involved
in endocytosis.";
FEBS Lett. 581:644-650(2007).
[6]
FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION AT TYR-231 AND
TYR-597, AND MUTAGENESIS OF TYR-231 AND TYR-597.
PubMed=19995918; DOI=10.1128/MCB.00330-09;
Cao H., Chen J., Krueger E.W., McNiven M.A.;
"SRC-mediated phosphorylation of dynamin and cortactin regulates the
'constitutive' endocytosis of transferrin.";
Mol. Cell. Biol. 30:781-792(2010).
[7]
PHOSPHORYLATION AT SER-764 BY CDK1, MUTAGENESIS OF SER-764, FUNCTION,
AND SUBCELLULAR LOCATION.
TISSUE=Lung;
PubMed=21195118; DOI=10.1016/j.bbamcr.2010.12.018;
Chircop M., Sarcevic B., Larsen M.R., Malladi C.S., Chau N.,
Zavortink M., Smith C.M., Quan A., Anggono V., Hains P.G.,
Graham M.E., Robinson P.J.;
"Phosphorylation of dynamin II at serine-764 is associated with
cytokinesis.";
Biochim. Biophys. Acta 1813:1689-1699(2011).
[8]
FUNCTION, SUBCELLULAR LOCATION, AND INTERACTION WITH CTTN AND ACTN1.
PubMed=21210813; DOI=10.1111/j.1471-4159.2011.07169.x;
Kurklinsky S., Chen J., McNiven M.A.;
"Growth cone morphology and spreading are regulated by a dynamin-
cortactin complex at point contacts in hippocampal neurons.";
J. Neurochem. 117:48-60(2011).
-!- FUNCTION: Microtubule-associated force-producing protein involved
in producing microtubule bundles and able to bind and hydrolyze
GTP. Plays a role in the regulation of neuron morphology, axon
growth and formation of neuronal growth cones (PubMed:21210813).
Plays an important role in vesicular trafficking processes, in
particular endocytosis (PubMed:19995918). Involved in cytokinesis
(PubMed:21195118). Regulates maturation of apoptotic cell corpse-
containing phagosomes by recruiting PIK3C3 to the phagosome
membrane (By similarity). {ECO:0000250|UniProtKB:P39054,
ECO:0000269|PubMed:19995918, ECO:0000269|PubMed:21195118,
ECO:0000269|PubMed:21210813}.
-!- CATALYTIC ACTIVITY: GTP + H(2)O = GDP + phosphate.
-!- SUBUNIT: Interacts with MYOF, SHANK1, SHANK2 and NOSTRIN (By
similarity). Interacts with SNX9. Interacts with SNX33 (via SH3
domain) (By similarity). Interacts with SH3BP4 (PubMed:16325581).
Interacts with MYO1E (via SH3 domain) (PubMed:17257598). Interacts
with PSTPIP1 (By similarity). Interacts with CTTN and ACTN1
(PubMed:21210813). Interacts with CTNND2 (By similarity). May
interact with PIK3C3 (By similarity). May be a component of a
complex composed of RAB5A (in GDP-bound form), DYN2 and PIK3C3 (By
similarity). {ECO:0000250|UniProtKB:P39054,
ECO:0000250|UniProtKB:P50570, ECO:0000269|PubMed:16325581,
ECO:0000269|PubMed:17257598, ECO:0000269|PubMed:21210813}.
-!- INTERACTION:
O08838:Amph; NbExp=2; IntAct=EBI-349613, EBI-80080;
Q9P0V3:SH3BP4 (xeno); NbExp=5; IntAct=EBI-349613, EBI-1049513;
Q96B97:SH3KBP1 (xeno); NbExp=4; IntAct=EBI-349613, EBI-346595;
Q9BX66:SORBS1 (xeno); NbExp=5; IntAct=EBI-349613, EBI-433642;
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:21210813}.
Cytoplasm, cytoskeleton {ECO:0000269|PubMed:21210813}. Cell
junction {ECO:0000269|PubMed:21210813}. Cell junction, synapse,
postsynaptic cell membrane, postsynaptic density
{ECO:0000250|UniProtKB:P50570}. Cell junction, synapse
{ECO:0000250|UniProtKB:P50570}. Midbody
{ECO:0000269|PubMed:21195118, ECO:0000269|PubMed:9725914}.
Membrane, clathrin-coated pit {ECO:0000269|PubMed:19995918}. Cell
projection, phagocytic cup {ECO:0000250|UniProtKB:P39054}.
Cytoplasmic vesicle, phagosome membrane
{ECO:0000250|UniProtKB:P39054}; Peripheral membrane protein
{ECO:0000250|UniProtKB:P39054}. Note=Microtubule-associated. Also
found in the postsynaptic density of neuronal cells (By
similarity). Colocalizes with CTTN at the basis of filopodia in
hippocampus neuron growth zones (PubMed:21210813). Co-localizes
with PIK3C3 and RAB5A to the nascent phagosome (By similarity).
{ECO:0000250|UniProtKB:P39054, ECO:0000250|UniProtKB:P50570}.
-!- SUBCELLULAR LOCATION: Isoform 2: Cytoplasmic vesicle, clathrin-
coated vesicle. Membrane, clathrin-coated pit.
-!- SUBCELLULAR LOCATION: Isoform 4: Cell membrane.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=ba, IIBA;
IsoId=P39052-1; Sequence=Displayed;
Name=2; Synonyms=aa;
IsoId=P39052-2; Sequence=VSP_001327;
Note=Sequestered to clathrin-coated pits and vesicles at the
plasma membrane and the Golgi apparatus.;
Name=3; Synonyms=bb, IIC;
IsoId=P39052-3; Sequence=VSP_001328;
Name=4; Synonyms=ab;
IsoId=P39052-4; Sequence=VSP_001327, VSP_001328;
Note=Localized to numerous punctate spots on the plasma
membrane.;
-!- TISSUE SPECIFICITY: Ubiquitously expressed. Brain expression is
restricted to glial cells and fibroblasts. Highest levels in the
testis. {ECO:0000269|PubMed:9725914}.
-!- PTM: Phosphorylation at Ser-764 by CDK1 is greatly increased upon
mitotic entry. It regulates cytokinesis downstream of calcineurin,
and does not affect clathrin-mediated endocytosis.
Dephosphorylated by calcineurin/PP2. Phosphorylated on tyrosine
residues after activation of SRC (PubMed:19995918).
{ECO:0000269|PubMed:19995918, ECO:0000269|PubMed:21195118}.
-!- SIMILARITY: Belongs to the TRAFAC class dynamin-like GTPase
superfamily. Dynamin/Fzo/YdjA family. {ECO:0000255|PROSITE-
ProRule:PRU01055}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; L25605; AAA19736.1; -; mRNA.
EMBL; L24562; AAA16746.1; -; mRNA.
PIR; A36878; A36878.
PIR; A53165; A53165.
PIR; B53165; B53165.
RefSeq; NP_037331.1; NM_013199.1. [P39052-1]
RefSeq; XP_006242670.1; XM_006242608.3. [P39052-2]
RefSeq; XP_006242674.1; XM_006242612.3. [P39052-4]
RefSeq; XP_006242675.1; XM_006242613.3. [P39052-3]
UniGene; Rn.11231; -.
ProteinModelPortal; P39052; -.
SMR; P39052; -.
BioGrid; 247779; 5.
CORUM; P39052; -.
DIP; DIP-33275N; -.
IntAct; P39052; 20.
MINT; P39052; -.
STRING; 10116.ENSRNOP00000060296; -.
BindingDB; P39052; -.
ChEMBL; CHEMBL2311233; -.
iPTMnet; P39052; -.
PhosphoSitePlus; P39052; -.
PaxDb; P39052; -.
PRIDE; P39052; -.
Ensembl; ENSRNOT00000010947; ENSRNOP00000010948; ENSRNOG00000007649. [P39052-1]
GeneID; 25751; -.
KEGG; rno:25751; -.
UCSC; RGD:2513; rat. [P39052-1]
CTD; 1785; -.
RGD; 2513; Dnm2.
eggNOG; KOG0446; Eukaryota.
eggNOG; COG0699; LUCA.
GeneTree; ENSGT00760000119213; -.
HOGENOM; HOG000161069; -.
HOVERGEN; HBG107833; -.
InParanoid; P39052; -.
KO; K01528; -.
OMA; ANRYIPE; -.
OrthoDB; EOG091G0EIQ; -.
PhylomeDB; P39052; -.
TreeFam; TF300362; -.
BRENDA; 3.6.5.5; 5301.
Reactome; R-RNO-190873; Gap junction degradation.
Reactome; R-RNO-196025; Formation of annular gap junctions.
Reactome; R-RNO-203641; NOSTRIN mediated eNOS trafficking.
Reactome; R-RNO-2132295; MHC class II antigen presentation.
Reactome; R-RNO-432720; Lysosome Vesicle Biogenesis.
Reactome; R-RNO-432722; Golgi Associated Vesicle Biogenesis.
Reactome; R-RNO-437239; Recycling pathway of L1.
Reactome; R-RNO-8856828; Clathrin-mediated endocytosis.
PRO; PR:P39052; -.
Proteomes; UP000002494; Chromosome 8.
Bgee; ENSRNOG00000007649; -.
ExpressionAtlas; P39052; baseline and differential.
Genevisible; P39052; RN.
GO; GO:0030054; C:cell junction; IDA:UniProtKB.
GO; GO:0005813; C:centrosome; IDA:RGD.
GO; GO:0045334; C:clathrin-coated endocytic vesicle; IDA:RGD.
GO; GO:0005905; C:clathrin-coated pit; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; IDA:RGD.
GO; GO:0005829; C:cytosol; IEA:Ensembl.
GO; GO:0005768; C:endosome; IDA:RGD.
GO; GO:0005794; C:Golgi apparatus; IDA:RGD.
GO; GO:0000139; C:Golgi membrane; IDA:RGD.
GO; GO:0030027; C:lamellipodium; IDA:RGD.
GO; GO:0005874; C:microtubule; IEA:UniProtKB-KW.
GO; GO:0030496; C:midbody; IEA:UniProtKB-SubCell.
GO; GO:0031966; C:mitochondrial membrane; IBA:GO_Central.
GO; GO:0005634; C:nucleus; IDA:RGD.
GO; GO:0048471; C:perinuclear region of cytoplasm; IDA:RGD.
GO; GO:0001891; C:phagocytic cup; IDA:RGD.
GO; GO:0030670; C:phagocytic vesicle membrane; IEA:UniProtKB-SubCell.
GO; GO:0001917; C:photoreceptor inner segment; IEA:Ensembl.
GO; GO:0005886; C:plasma membrane; IDA:RGD.
GO; GO:0014069; C:postsynaptic density; IEA:UniProtKB-SubCell.
GO; GO:0045211; C:postsynaptic membrane; ISS:UniProtKB.
GO; GO:0032991; C:protein-containing complex; IDA:RGD.
GO; GO:0032587; C:ruffle membrane; IDA:RGD.
GO; GO:0005802; C:trans-Golgi network; IDA:RGD.
GO; GO:0005525; F:GTP binding; TAS:RGD.
GO; GO:0003924; F:GTPase activity; IDA:RGD.
GO; GO:0008017; F:microtubule binding; IBA:GO_Central.
GO; GO:0050998; F:nitric-oxide synthase binding; IDA:RGD.
GO; GO:0036312; F:phosphatidylinositol 3-kinase regulatory subunit binding; IDA:RGD.
GO; GO:0044877; F:protein-containing complex binding; IDA:RGD.
GO; GO:0017124; F:SH3 domain binding; IEA:Ensembl.
GO; GO:0035904; P:aorta development; IEA:Ensembl.
GO; GO:0071245; P:cellular response to carbon monoxide; IEP:RGD.
GO; GO:1903351; P:cellular response to dopamine; IDA:RGD.
GO; GO:0071732; P:cellular response to nitric oxide; IEP:RGD.
GO; GO:0071481; P:cellular response to X-ray; IEP:RGD.
GO; GO:0060976; P:coronary vasculature development; IEA:Ensembl.
GO; GO:0003374; P:dynamin family protein polymerization involved in mitochondrial fission; IBA:GO_Central.
GO; GO:0006897; P:endocytosis; TAS:RGD.
GO; GO:0002031; P:G-protein coupled receptor internalization; IMP:RGD.
GO; GO:0006893; P:Golgi to plasma membrane transport; IMP:RGD.
GO; GO:0044351; P:macropinocytosis; IMP:RGD.
GO; GO:0061025; P:membrane fusion; IBA:GO_Central.
GO; GO:0000266; P:mitochondrial fission; IBA:GO_Central.
GO; GO:1903526; P:negative regulation of membrane tubulation; IEA:Ensembl.
GO; GO:1902856; P:negative regulation of non-motile cilium assembly; IMP:RGD.
GO; GO:0030512; P:negative regulation of transforming growth factor beta receptor signaling pathway; IMP:RGD.
GO; GO:0048812; P:neuron projection morphogenesis; IMP:UniProtKB.
GO; GO:0006909; P:phagocytosis; IEA:UniProtKB-KW.
GO; GO:2000370; P:positive regulation of clathrin-dependent endocytosis; IMP:RGD.
GO; GO:0045807; P:positive regulation of endocytosis; IMP:RGD.
GO; GO:0010592; P:positive regulation of lamellipodium assembly; IMP:RGD.
GO; GO:0045429; P:positive regulation of nitric oxide biosynthetic process; IMP:RGD.
GO; GO:0050766; P:positive regulation of phagocytosis; IMP:RGD.
GO; GO:1903408; P:positive regulation of sodium:potassium-exchanging ATPase activity; IMP:RGD.
GO; GO:1900026; P:positive regulation of substrate adhesion-dependent cell spreading; IMP:RGD.
GO; GO:0006898; P:receptor-mediated endocytosis; IDA:RGD.
GO; GO:0030516; P:regulation of axon extension; IMP:UniProtKB.
GO; GO:1903358; P:regulation of Golgi organization; IMP:RGD.
GO; GO:0035020; P:regulation of Rac protein signal transduction; IMP:RGD.
GO; GO:0042220; P:response to cocaine; IEP:RGD.
GO; GO:0009416; P:response to light stimulus; IEP:RGD.
GO; GO:0007283; P:spermatogenesis; IEP:RGD.
GO; GO:0033572; P:transferrin transport; IEA:Ensembl.
GO; GO:0003281; P:ventricular septum development; IEA:Ensembl.
CDD; cd08771; DLP_1; 1.
Gene3D; 2.30.29.30; -; 1.
InterPro; IPR027188; DNM2.
InterPro; IPR000375; Dynamin_central.
InterPro; IPR001401; Dynamin_GTPase.
InterPro; IPR019762; Dynamin_GTPase_CS.
InterPro; IPR022812; Dynamin_SF.
InterPro; IPR030381; G_DYNAMIN_dom.
InterPro; IPR003130; GED.
InterPro; IPR020850; GED_dom.
InterPro; IPR027417; P-loop_NTPase.
InterPro; IPR011993; PH-like_dom_sf.
InterPro; IPR001849; PH_domain.
PANTHER; PTHR11566; PTHR11566; 1.
PANTHER; PTHR11566:SF23; PTHR11566:SF23; 1.
Pfam; PF01031; Dynamin_M; 1.
Pfam; PF00350; Dynamin_N; 1.
Pfam; PF02212; GED; 1.
Pfam; PF00169; PH; 1.
PRINTS; PR00195; DYNAMIN.
SMART; SM00053; DYNc; 1.
SMART; SM00302; GED; 1.
SMART; SM00233; PH; 1.
SUPFAM; SSF52540; SSF52540; 1.
PROSITE; PS00410; G_DYNAMIN_1; 1.
PROSITE; PS51718; G_DYNAMIN_2; 1.
PROSITE; PS51388; GED; 1.
PROSITE; PS50003; PH_DOMAIN; 1.
1: Evidence at protein level;
Acetylation; Alternative splicing; Cell junction; Cell membrane;
Cell projection; Coated pit; Complete proteome; Cytoplasm;
Cytoplasmic vesicle; Cytoskeleton; Endocytosis; GTP-binding;
Hydrolase; Membrane; Microtubule; Motor protein; Nucleotide-binding;
Phagocytosis; Phosphoprotein; Postsynaptic cell membrane;
Reference proteome; Synapse.
CHAIN 1 870 Dynamin-2.
/FTId=PRO_0000206572.
DOMAIN 28 294 Dynamin-type G. {ECO:0000255|PROSITE-
ProRule:PRU01055}.
DOMAIN 519 625 PH. {ECO:0000255|PROSITE-
ProRule:PRU00145}.
DOMAIN 653 744 GED. {ECO:0000255|PROSITE-
ProRule:PRU00720}.
NP_BIND 38 46 GTP. {ECO:0000250|UniProtKB:O00429}.
NP_BIND 205 211 GTP. {ECO:0000250|UniProtKB:O00429}.
NP_BIND 236 239 GTP. {ECO:0000250|UniProtKB:O00429}.
REGION 38 45 G1 motif. {ECO:0000255|PROSITE-
ProRule:PRU01055}.
REGION 64 66 G2 motif. {ECO:0000255|PROSITE-
ProRule:PRU01055}.
REGION 136 139 G3 motif. {ECO:0000255|PROSITE-
ProRule:PRU01055}.
REGION 205 208 G4 motif. {ECO:0000255|PROSITE-
ProRule:PRU01055}.
REGION 235 238 G5 motif. {ECO:0000255|PROSITE-
ProRule:PRU01055}.
COMPBIAS 747 866 Pro-rich.
MOD_RES 231 231 Phosphotyrosine.
{ECO:0000305|PubMed:19995918}.
MOD_RES 299 299 N6-acetyllysine.
{ECO:0000250|UniProtKB:P39054}.
MOD_RES 597 597 Phosphotyrosine.
{ECO:0000305|PubMed:19995918}.
MOD_RES 598 598 N6-acetyllysine.
{ECO:0000250|UniProtKB:P50570}.
MOD_RES 755 755 Phosphothreonine.
{ECO:0000250|UniProtKB:P50570}.
MOD_RES 764 764 Phosphoserine; by CDK1.
{ECO:0000269|PubMed:21195118}.
VAR_SEQ 407 444 LAFEAIVKKQVVKLKEPCLKCVDLVIQELISTVRQCTS ->
MAFEAIVKKQLVKLKEPSLKCVDLVVSELATVIKKCAE
(in isoform 2 and isoform 4).
{ECO:0000303|PubMed:8308025}.
/FTId=VSP_001327.
VAR_SEQ 516 519 Missing (in isoform 3 and isoform 4).
{ECO:0000303|PubMed:8290576,
ECO:0000303|PubMed:8308025}.
/FTId=VSP_001328.
MUTAGEN 231 231 Y->F: Strongly reduced phosphorylation.
Decreases receptor-mediated endocytosis.
{ECO:0000269|PubMed:19995918}.
MUTAGEN 597 597 Y->F: Strongly reduced phosphorylation.
Decreases receptor-mediated endocytosis.
{ECO:0000269|PubMed:19995918}.
MUTAGEN 764 764 S->A: Reduces proline-rich domain
phosphorylation by 80%.
{ECO:0000269|PubMed:21195118}.
MUTAGEN 764 764 S->E: Abolishes midbody localization and
shows increased multinucleation.
{ECO:0000269|PubMed:21195118}.
CONFLICT 298 298 S -> T (in Ref. 2; AAA16746).
{ECO:0000305}.
CONFLICT 389 389 S -> T (in Ref. 2; AAA16746).
{ECO:0000305}.
CONFLICT 487 487 N -> K (in Ref. 2; AAA16746).
{ECO:0000305}.
CONFLICT 637 637 G -> E (in Ref. 2; AAA16746).
{ECO:0000305}.
CONFLICT 719 719 Missing (in Ref. 2; AAA16746).
{ECO:0000305}.
CONFLICT 786 791 GPTPGP -> PHTGA (in Ref. 2; AAA16746).
{ECO:0000305}.
SEQUENCE 870 AA; 98230 MW; 3802DBAFA3ABBE98 CRC64;
MGNRGMEELI PLVNKLQDAF SSIGQSCHLD LPQIAVVGGQ SAGKSSVLEN FVGRDFLPRG
SGIVTRRPLI LQLIFSKTEY AEFLHCKSKK FTDFDEVRQE IEAETDRVTG TNKGISPVPI
NLRVYSPHVL NLTLIDLPGI TKVPVGDQPP DIEYQIKDMI LQFISRESSL ILAVTPANMD
LANSDALKLA KEVDPQGLRT IGVITKLDLM DEGTDARDVL ENKLLPLRRG YIGVVNRSQK
DIEGRKDIRA ALAAERKFFL SHPAYRHMAD RMGTPHLQKT LNQQLTNHIR ESLPTLRSKL
QSQLLSLEKE VEEYKNFRPD DPTRKTKALL QMVQQFGVDF EKRIEGSGDQ VDTLELSGGA
RINRIFHERF PFELVKMEFD EKDLRREISY AIKNIHGVRT GLFTPDLAFE AIVKKQVVKL
KEPCLKCVDL VIQELISTVR QCTSKLSSYP RLREETERIV TTYIREREGR TKDQILLLID
IEQSYINTNH EDFIGFANAQ QRSTQLNKKR AIPNQGEILV IRRGWLTINN ISLMKGGSKE
YWFVLTAESL SWYKDEEEKE KKYMLPLDNL KIRDVEKGFM SNKHVFAIFN TEQRNVYKDL
RQIELACDSQ EDVDSWKASF LRAGVYPEKD QAENEDGAQE NTFSMDPQLE RQVETIRNLV
DSYVAIINKS IRDLMPKTIM HLMINNTKAF IHHELLAYLY SSADQSSLME ESAEQAQRRD
DMLRMYHALK EALNIIGDIS TSTVSTPVPP PVDDTWLQNT SSHSPTPQRR PVSSVHPPGR
PPAVRGPTPG PPLIPMPVGA TSSFSAPPIP SRPGPQNVFA NNDPFSAPPQ IPSRPARIPP
GIPPGVPSRR APAAPSRPTI IRPAEPSLLD


Related products :

Catalog number Product name Quantity
32-146 Dynamin-1 (Dyn1), with 864-amino acid protein (about 95kDa), belongs to the dynamin family. Dynamin-1 (neuron-specific), dynamin-2 (ubiquitously expressed), and dynamin-3 (expressed only in the testis 0.1 mL
32-147 Dynamin-2 (Dyn2), with 870-amino acid protein (about 95kDa), belongs to the dynamin family. Dynamin-1 (neuron-specific), dynamin-2 (ubiquitously expressed), and dynamin-3 (expressed only in the testis 0.1 mL
EIAAB11600 DLP1,DNM1L,Dnm1p_Vps1p-like protein,DRP1,DVLP,Dymple,Dynamin family member proline-rich carboxyl-terminal domain less,Dynamin-1-like protein,Dynamin-like protein,Dynamin-like protein 4,Dynamin-like pr
E1962r ELISA B-dynamin,D100,Dnm,Dnm1,Dynamin, brain,Dynamin-1,Rat,Rattus norvegicus 96T
EIAAB12198 DNM3,Dynamin, testicular,Dynamin-3,Homo sapiens,Human,KIAA0820,T-dynamin
E1962r ELISA kit B-dynamin,D100,Dnm,Dnm1,Dynamin, brain,Dynamin-1,Rat,Rattus norvegicus 96T
U1962r CLIA kit B-dynamin,D100,Dnm,Dnm1,Dynamin, brain,Dynamin-1,Rat,Rattus norvegicus 96T
U1962r CLIA B-dynamin,D100,Dnm,Dnm1,Dynamin, brain,Dynamin-1,Rat,Rattus norvegicus 96T
EIAAB12197 Dnm3,Dyn3,Dynamin, testicular,Dynamin-3,Rat,Rattus norvegicus,T-dynamin
EIAAB11598 Dnm1l,Drp1,Dymple,Dynamin family member proline-rich carboxyl-terminal domain less,Dynamin-1-like protein,Dynamin-related protein 1,Mouse,Mus musculus
EIAAB29675 Dynamin PRD-interacting protein,Dynamin proline-rich domain-interacting protein,Pacsin1,Protein kinase C and casein kinase substrate in neurons protein 1,Rat,Rattus norvegicus,SdpI,Synaptic, dynamin-a
E1164m ELISA Dnm2,Dyn2,Dynamin UDNM,Dynamin-2,Mouse,Mus musculus 96T
E1164m ELISA kit Dnm2,Dyn2,Dynamin UDNM,Dynamin-2,Mouse,Mus musculus 96T
U1164m CLIA Dnm2,Dyn2,Dynamin UDNM,Dynamin-2,Mouse,Mus musculus 96T
Mab-606045 Monoclonal Antibodies: Dynamin-1; Specificity: Dynamin-1 ; Application: WB, IHC, Elisa 0.1ml
Mab-607011 Monoclonal Antibodies: Dynamin-2; Specificity: Dynamin-2 ; Application: WB, IHC, Elisa 0.1ml
bs-0574P Peptides: Dynamin 2(Anti-Human Dynamin-2 ) Protein Length:12-25 amino acids. 200ug lyophilized
LF-MA10088 anti-Dynamin 2 (6C9), Mouse monoclonal to Dynamin 2, Isotype IgG1, Host Mouse 100 ug
LF-PA41410 anti-Dynamin 1, Rabbit polyclonal to Dynamin 1, Isotype IgG, Host Rabbit 100 ul
EIAAB11601 Dlp1,Dnm1l,Dynamin-1-like protein,Dynamin-like protein,Rat,Rattus norvegicus
AO1062a Dynamin-1 Antibody Mouse Monoclonal Antibody to Dynamin-1 Applications WB, IHC, E 0.1ml
251634-22-7 Dynamin inhibitory peptide, myristoylated Dynamin inhibitory pept 1g
AO1089a Dynamin-2 Antibody Mouse Monoclonal Antibody to Dynamin-2 Applications WB, IHC, E 0.1ml
AHP899 SHEEP ANTI DYNAMIN (pSer774), Product Type Polyclonal Antibody, Specificity DYNAMIN , Target Species Rat, Host Sheep, Format Purified, Isotypes Polyclonal IgG, Applications C, IF, WB*, Clone 0.1 ml
AHP907 SHEEP ANTI DYNAMIN (pSer778), Product Type Polyclonal Antibody, Specificity DYNAMIN , Target Species Rat, Host Sheep, Format Purified, Isotypes Polyclonal IgG, Applications WB*, Clone 0.1 ml


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur