Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Dynein assembly factor 1, axonemal (Leucine-rich repeat-containing protein 50)

 DAAF1_HUMAN             Reviewed;         725 AA.
Q8NEP3; B4DJA3; Q69YI8; Q69YJ0; Q69YW5; Q96LP3; Q96MB6;
18-APR-2006, integrated into UniProtKB/Swiss-Prot.
25-NOV-2008, sequence version 5.
25-OCT-2017, entry version 133.
RecName: Full=Dynein assembly factor 1, axonemal;
AltName: Full=Leucine-rich repeat-containing protein 50;
Name=DNAAF1; Synonyms=LRRC50;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), AND
VARIANTS ARG-393; LEU-502; SER-633; PRO-659 AND THR-675.
TISSUE=Subthalamic nucleus, and Testis;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15616553; DOI=10.1038/nature03187;
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X.,
Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A.,
Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.,
Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L.,
Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A.,
Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D.,
Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J.,
Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M.,
Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I.,
Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W.,
Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A.,
Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S.,
Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J.,
Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D.,
Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L.,
Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A.,
Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L.,
Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N.,
Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M.,
Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L.,
Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D.,
Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P.,
Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M.,
Rubin E.M., Pennacchio L.A.;
"The sequence and analysis of duplication-rich human chromosome 16.";
Nature 432:988-994(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANTS
ARG-393; LEU-502; CYS-545; SER-633; PRO-659 AND THR-675.
TISSUE=Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-548 AND 567-725 (ISOFORM
1), AND VARIANTS ARG-393 AND LEU-502.
TISSUE=Testis;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[5]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=18385425; DOI=10.1681/ASN.2007080917;
van Rooijen E., Giles R.H., Voest E.E., van Rooijen C.,
Schulte-Merker S., van Eeden F.J.;
"LRRC50, a conserved ciliary protein implicated in polycystic kidney
disease.";
J. Am. Soc. Nephrol. 19:1128-1138(2008).
[6]
FUNCTION, AND INVOLVEMENT IN CILD13.
PubMed=19944400; DOI=10.1016/j.ajhg.2009.10.018;
Loges N.T., Olbrich H., Becker-Heck A., Haffner K., Heer A.,
Reinhard C., Schmidts M., Kispert A., Zariwala M.A., Leigh M.W.,
Knowles M.R., Zentgraf H., Seithe H., Nurnberg G., Nurnberg P.,
Reinhardt R., Omran H.;
"Deletions and point mutations of LRRC50 cause primary ciliary
dyskinesia due to dynein arm defects.";
Am. J. Hum. Genet. 85:883-889(2009).
[7]
FUNCTION, TISSUE SPECIFICITY, AND VARIANTS CILD13 42-GLU--LYS-117 DEL
AND ARG-175.
PubMed=19944405; DOI=10.1016/j.ajhg.2009.11.008;
Duquesnoy P., Escudier E., Vincensini L., Freshour J., Bridoux A.M.,
Coste A., Deschildre A., de Blic J., Legendre M., Montantin G.,
Tenreiro H., Vojtek A.M., Loussert C., Clement A., Escalier D.,
Bastin P., Mitchell D.R., Amselem S.;
"Loss-of-function mutations in the human ortholog of Chlamydomonas
reinhardtii ODA7 disrupt dynein arm assembly and cause primary ciliary
dyskinesia.";
Am. J. Hum. Genet. 85:890-896(2009).
[8]
INVOLVEMENT IN CILD13.
PubMed=25186273; DOI=10.1183/09031936.00052014;
Raidt J., Wallmeier J., Hjeij R., Onnebrink J.G., Pennekamp P.,
Loges N.T., Olbrich H., Haeffner K., Dougherty G.W., Omran H.,
Werner C.;
"Ciliary beat pattern and frequency in genetic variants of primary
ciliary dyskinesia.";
Eur. Respir. J. 44:1579-1588(2014).
-!- FUNCTION: Cilium-specific protein required for the stability of
the ciliary architecture. Plays a role in cytoplasmic preassembly
of dynein arms. Involved in regulation of microtubule-based cilia
and actin-based brush border microvilli.
{ECO:0000269|PubMed:18385425, ECO:0000269|PubMed:19944400,
ECO:0000269|PubMed:19944405}.
-!- SUBCELLULAR LOCATION: Cell projection, cilium
{ECO:0000269|PubMed:18385425}. Cytoplasm
{ECO:0000269|PubMed:18385425}. Cytoplasm, cytoskeleton, spindle
pole {ECO:0000269|PubMed:18385425}. Note=In HEK293T cells, it is
diffusely cytoplasmic and concentrates at the mitotic spindle
poles, while in MDCK cells, it localizes in the cilium. In vivo,
this protein is probably restricted to the cilium.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q8NEP3-1; Sequence=Displayed;
Name=2;
IsoId=Q8NEP3-2; Sequence=VSP_036354, VSP_036355;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q8NEP3-3; Sequence=VSP_036356;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Mainly expressed in trachea and testis.
{ECO:0000269|PubMed:19944405}.
-!- DISEASE: Ciliary dyskinesia, primary, 13 (CILD13) [MIM:613193]: A
disorder characterized by abnormalities of motile cilia.
Respiratory infections leading to chronic inflammation and
bronchiectasis are recurrent, due to defects in the respiratory
cilia; reduced fertility is often observed in male patients due to
abnormalities of sperm tails. Half of the patients exhibit
randomization of left-right body asymmetry and situs inversus, due
to dysfunction of monocilia at the embryonic node. Primary ciliary
dyskinesia associated with situs inversus is referred to as
Kartagener syndrome. At ultrastructural level, CILD13 is
characterized by a marked reduction or absence of both dynein arms
from the patients cilia. {ECO:0000269|PubMed:19944400,
ECO:0000269|PubMed:19944405, ECO:0000269|PubMed:25186273}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-!- SIMILARITY: Belongs to the DNAAF1 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAB71645.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AK057238; BAB71392.1; -; mRNA.
EMBL; AK058059; BAB71645.1; ALT_INIT; mRNA.
EMBL; AK295990; BAG58765.1; -; mRNA.
EMBL; AC009123; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC040169; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC024009; AAH24009.3; -; mRNA.
EMBL; AL137334; CAH10706.1; -; mRNA.
EMBL; AL833328; CAH10390.1; -; mRNA.
EMBL; AL833336; CAH10394.1; -; mRNA.
CCDS; CCDS10943.2; -. [Q8NEP3-1]
RefSeq; NP_001305685.1; NM_001318756.1. [Q8NEP3-2]
RefSeq; NP_848547.4; NM_178452.5. [Q8NEP3-1]
UniGene; Hs.310164; -.
ProteinModelPortal; Q8NEP3; -.
BioGrid; 125839; 5.
IntAct; Q8NEP3; 5.
STRING; 9606.ENSP00000367815; -.
iPTMnet; Q8NEP3; -.
PhosphoSitePlus; Q8NEP3; -.
BioMuta; DNAAF1; -.
DMDM; 215274261; -.
PaxDb; Q8NEP3; -.
PeptideAtlas; Q8NEP3; -.
PRIDE; Q8NEP3; -.
Ensembl; ENST00000378553; ENSP00000367815; ENSG00000154099. [Q8NEP3-1]
Ensembl; ENST00000563093; ENSP00000457373; ENSG00000154099. [Q8NEP3-3]
GeneID; 123872; -.
KEGG; hsa:123872; -.
UCSC; uc002fhl.5; human. [Q8NEP3-1]
CTD; 123872; -.
DisGeNET; 123872; -.
EuPathDB; HostDB:ENSG00000154099.17; -.
GeneCards; DNAAF1; -.
GeneReviews; DNAAF1; -.
H-InvDB; HIX0013289; -.
HGNC; HGNC:30539; DNAAF1.
HPA; HPA041166; -.
MalaCards; DNAAF1; -.
MIM; 613190; gene.
MIM; 613193; phenotype.
neXtProt; NX_Q8NEP3; -.
OpenTargets; ENSG00000154099; -.
Orphanet; 244; Primary ciliary dyskinesia.
PharmGKB; PA142671510; -.
eggNOG; ENOG410IG8N; Eukaryota.
eggNOG; ENOG410XQAN; LUCA.
GeneTree; ENSGT00900000141008; -.
HOVERGEN; HBG066969; -.
InParanoid; Q8NEP3; -.
KO; K19750; -.
OMA; CLFLQVN; -.
OrthoDB; EOG091G01J2; -.
PhylomeDB; Q8NEP3; -.
TreeFam; TF315818; -.
ChiTaRS; DNAAF1; human.
GeneWiki; LRRC50; -.
GenomeRNAi; 123872; -.
PRO; PR:Q8NEP3; -.
Proteomes; UP000005640; Chromosome 16.
Bgee; ENSG00000154099; -.
CleanEx; HS_LRRC50; -.
ExpressionAtlas; Q8NEP3; baseline and differential.
Genevisible; Q8NEP3; HS.
GO; GO:0005930; C:axoneme; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; NAS:BHF-UCL.
GO; GO:0005829; C:cytosol; IDA:HPA.
GO; GO:0016607; C:nuclear speck; IDA:HPA.
GO; GO:0005886; C:plasma membrane; IDA:HPA.
GO; GO:0000922; C:spindle pole; IEA:UniProtKB-SubCell.
GO; GO:0070840; F:dynein complex binding; IMP:UniProtKB.
GO; GO:0070286; P:axonemal dynein complex assembly; IMP:UniProtKB.
GO; GO:0060271; P:cilium assembly; IMP:UniProtKB.
GO; GO:0003341; P:cilium movement; IMP:BHF-UCL.
GO; GO:0071907; P:determination of digestive tract left/right asymmetry; IMP:BHF-UCL.
GO; GO:0071910; P:determination of liver left/right asymmetry; IMP:BHF-UCL.
GO; GO:0035469; P:determination of pancreatic left/right asymmetry; IMP:BHF-UCL.
GO; GO:0060287; P:epithelial cilium movement involved in determination of left/right asymmetry; IC:BHF-UCL.
GO; GO:0001947; P:heart looping; IMP:BHF-UCL.
GO; GO:0036159; P:inner dynein arm assembly; IMP:BHF-UCL.
GO; GO:0060972; P:left/right pattern formation; IMP:BHF-UCL.
GO; GO:0030324; P:lung development; IMP:BHF-UCL.
GO; GO:0044458; P:motile cilium assembly; IMP:BHF-UCL.
GO; GO:0036158; P:outer dynein arm assembly; IMP:BHF-UCL.
GO; GO:0003356; P:regulation of cilium beat frequency; IMP:BHF-UCL.
Gene3D; 3.80.10.10; -; 1.
InterPro; IPR027734; DNAAF1.
InterPro; IPR032675; L_dom-like.
InterPro; IPR001611; Leu-rich_rpt.
PANTHER; PTHR45256; PTHR45256; 2.
PROSITE; PS51450; LRR; 6.
1: Evidence at protein level;
Alternative splicing; Cell projection; Ciliopathy; Cilium;
Complete proteome; Cytoplasm; Cytoskeleton; Disease mutation;
Kartagener syndrome; Leucine-rich repeat; Phosphoprotein;
Polymorphism; Primary ciliary dyskinesia; Reference proteome; Repeat.
CHAIN 1 725 Dynein assembly factor 1, axonemal.
/FTId=PRO_0000232889.
REPEAT 107 129 LRR 1.
REPEAT 130 151 LRR 2.
REPEAT 152 173 LRR 3.
REPEAT 174 195 LRR 4.
REPEAT 196 217 LRR 5.
REPEAT 221 242 LRR 6.
DOMAIN 256 294 LRRCT.
COMPBIAS 391 513 Pro-rich.
MOD_RES 358 358 Phosphoserine.
{ECO:0000250|UniProtKB:Q6AYH9}.
MOD_RES 559 559 Phosphothreonine.
{ECO:0000250|UniProtKB:Q9D2H9}.
MOD_RES 562 562 Phosphoserine.
{ECO:0000250|UniProtKB:Q9D2H9}.
MOD_RES 583 583 Phosphoserine.
{ECO:0000250|UniProtKB:Q9D2H9}.
VAR_SEQ 1 252 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_036354.
VAR_SEQ 343 343 R -> RGMRSAEDNSPRVPLRL (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_036355.
VAR_SEQ 409 725 GPEPEGTLPAETLLLSSPVEVKGEDGDGEPEGTLPAEAPPP
PPPVEVKGEDGDQEPEGTLPAETLLLSPPVKVKGEDGDREP
EGTLPAEAPPPPPLGAAREEPTPQAVATEGVFVTELDGTRT
EDLETIRLETKETFCIDDLPDLEDDDETGKSLEDQNMCFPK
IEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDT
SKAARVPFTDIFKKEAKRDLEIRKQDTKSPRPLIQELSDED
PSGQLLMPPTCQRDAAPLTSSGDRDSDFLAASSPVPTESAA
TPPETCVGVAQPSQALPTWDLTAFPAPKAS -> DPATVTA
CEG (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_036356.
VARIANT 42 117 Missing (in CILD13).
{ECO:0000269|PubMed:19944405}.
/FTId=VAR_063097.
VARIANT 175 175 L -> R (in CILD13; dbSNP:rs267607227).
{ECO:0000269|PubMed:19944405}.
/FTId=VAR_063098.
VARIANT 387 387 D -> E (in dbSNP:rs36062234).
/FTId=VAR_047662.
VARIANT 393 393 K -> R (in dbSNP:rs17856705).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:17974005}.
/FTId=VAR_047663.
VARIANT 432 432 E -> D (in dbSNP:rs9972733).
/FTId=VAR_047664.
VARIANT 502 502 P -> L (in dbSNP:rs11644164).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:17974005}.
/FTId=VAR_047665.
VARIANT 545 545 F -> C (in dbSNP:rs17856706).
{ECO:0000269|PubMed:15489334}.
/FTId=VAR_047666.
VARIANT 633 633 L -> S (in dbSNP:rs2288020).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15489334}.
/FTId=VAR_047667.
VARIANT 659 659 L -> P (in dbSNP:rs2288022).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15489334}.
/FTId=VAR_047668.
VARIANT 659 659 L -> V (in dbSNP:rs2288021).
/FTId=VAR_047669.
VARIANT 675 675 S -> T (in dbSNP:rs2288023).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15489334}.
/FTId=VAR_047670.
VARIANT 703 703 G -> R (in dbSNP:rs4150188).
/FTId=VAR_047671.
VARIANT 712 712 P -> A (in dbSNP:rs4150187).
/FTId=VAR_047672.
CONFLICT 307 307 Q -> E (in Ref. 4; CAH10390).
{ECO:0000305}.
CONFLICT 366 366 P -> L (in Ref. 4; CAH10394).
{ECO:0000305}.
CONFLICT 457 457 G -> R (in Ref. 2; BAG58765).
{ECO:0000305}.
CONFLICT 485 485 D -> G (in Ref. 4; CAH10394).
{ECO:0000305}.
SEQUENCE 725 AA; 80026 MW; CFDBF86796FA61B0 CRC64;
MHPEPSEPAT GGAAELDCAQ EPGVEESAGD HGSAGRGGCK EEINDPKEIC VGSSDTSYHS
QQKQSGDNGS GGHFAHPRED REDRGPRMTK SSLQKLCKQH KLYITPALND TLYLHFKGFD
RIENLEEYTG LRCLWLQSNG IQKIENLEAQ TELRCLFLQM NLLRKIENLE PLQKLDALNL
SNNYIKTIEN LSCLPVLNTL QMAHNHLETV EDIQHLQECL RLCVLDLSHN KLSDPEILSI
LESMPDLRVL NLMGNPVIRQ IPNYRRTVTV RLKHLTYLDD RPVFPKDRAC AEAWARGGYA
AEKEERQQWE SRERKKITDS IEALAMIKQR AEERKRQRES QERGEMTSSD DGENVPASAE
GKEEPPGDRE TRQKMELFVK ESFEAKDELC PEKPSGEEPP VEAKREDGGP EPEGTLPAET
LLLSSPVEVK GEDGDGEPEG TLPAEAPPPP PPVEVKGEDG DQEPEGTLPA ETLLLSPPVK
VKGEDGDREP EGTLPAEAPP PPPLGAAREE PTPQAVATEG VFVTELDGTR TEDLETIRLE
TKETFCIDDL PDLEDDDETG KSLEDQNMCF PKIEVISSLS DDSDPELDYT SLPVLENLPT
DTLSNIFAVS KDTSKAARVP FTDIFKKEAK RDLEIRKQDT KSPRPLIQEL SDEDPSGQLL
MPPTCQRDAA PLTSSGDRDS DFLAASSPVP TESAATPPET CVGVAQPSQA LPTWDLTAFP
APKAS


Related products :

Catalog number Product name Quantity
EIAAB10357 Bos taurus,Bovine,DNAAF1,Dynein assembly factor 1, axonemal,Leucine-rich repeat-containing protein 50,LRRC50
EIAAB10356 Dnaaf1,Dynein assembly factor 1, axonemal,Leucine-rich repeat-containing protein 50,Lrrc50,Rat,Rattus norvegicus
EIAAB10358 Dnaaf1,Dynein assembly factor 1, axonemal,Leucine-rich repeat-containing protein 50,Lrrc50,Mouse,Mus musculus
EIAAB10359 DNAAF1,Dynein assembly factor 1, axonemal,Homo sapiens,Human,Leucine-rich repeat-containing protein 50,LRRC50
EIAAB12154 Ankyrin repeat and SOCS box protein 14,ASB14,ASB-14,Axonemal beta dynein heavy chain 12,Bos taurus,Bovine,Ciliary dynein heavy chain 12,DNAH12,Dynein heavy chain 12, axonemal
EIAAB12152 Axonemal beta dynein heavy chain 12,Axonemal dynein heavy chain 12-like protein,Axonemal dynein heavy chain 7-like protein,Ciliary dynein heavy chain 12,Dnah12,Dnah12l,Dnah7l,Dnahc12,Dnahc7l,Dynein he
EIAAB12166 Axob,Axonemal beta dynein heavy chain 7,Axonemal dynein heavy chain b,Ciliary dynein heavy chain 7,Dlp7,Dnah7,Dynein heavy chain 7, axonemal,Dynein-like protein 7,Rat,Rattus norvegicus
EIAAB12153 Axonemal beta dynein heavy chain 12,Axonemal dynein heavy chain 12-like protein,Axonemal dynein heavy chain 7-like protein,Ciliary dynein heavy chain 12,DHC3,DLP12,DNAH12,DNAH12L,DNAH7L,DNAHC3,DNHD2,D
E12774r Rat ELISA Kit FOR Dynein assembly factor 3, axonemal 96T
CSB-EL013150HU Human Dynein assembly factor 1, axonemal(LRRC50) ELISA kit 96T
CSB-EL013150HU Human Dynein assembly factor 1, axonemal(LRRC50) ELISA kit SpeciesHuman 96T
DAAF1_BOVIN ELISA Kit FOR Dynein assembly factor 1, axonemal; organism: Bovine; gene name: DNAAF1 96T
DAAF1_MOUSE ELISA Kit FOR Dynein assembly factor 1, axonemal; organism: Mouse; gene name: Dnaaf1 96T
EIAAB12159 Axonemal beta dynein heavy chain 2,Ciliary dynein heavy chain 2,DNAH2,DNAHC2,DNHD3,Dynein heavy chain 2, axonemal,Dynein heavy chain domain-containing protein 3,Homo sapiens,Human,KIAA1503
EIAAB30918 Homo sapiens,Human,KIAA0931,PH domain leucine-rich repeat-containing protein phosphatase 2,PH domain leucine-rich repeat-containing protein phosphatase-like,PHLPP2,PHLPPL,PHLPP-like
EIAAB12165 Axonemal beta dynein heavy chain 7,Ciliary dynein heavy chain 7,DNAH7,Dynein heavy chain 7, axonemal,Dynein heavy chain-like protein 2,hDHC2,Homo sapiens,Human,KIAA0944
EIAAB43981 Leucine-rich repeat-containing protein KIAA0644 homolog,Rat,Rattus norvegicus,TLR4 interactor with leucine rich repeats,Tril
EIAAB12147 Axonemal beta dynein heavy chain 1,Ciliary dynein heavy chain 1,DHC7,DNAH1,DNAHC1,Dynein heavy chain 1, axonemal,hDHC7,Heat shock regulated protein 1,Homo sapiens,HSRF-1,Human,KIAA1410
20-372-60235 F-box and leucine-rich repeat protein 4 (FBXL4) - Mouse monoclonal anti-human FBXL4 antibody; F-box and leucine-rich repeat protein 4; F-box protein FBL4_FBL5 Monoclonal 0.1 mg
EIAAB30919 Mouse,Mus musculus,PH domain leucine-rich repeat-containing protein phosphatase 2,PH domain leucine-rich repeat-containing protein phosphatase-like,Phlpp2,Phlppl,PHLPP-like
EIAAB43980 Homo sapiens,Human,KIAA0644,Leucine-rich repeat-containing protein KIAA0644,TLR4 interactor with leucine rich repeats,TRIL
30-556 LRRC8 is a multi-pass membrane protein. It contains 13 LRR (leucine-rich) repeats. LRRC8 involved in B cell development belongs to a novel family of leucine-rich repeat proteins 0.05 mg
EIAAB12157 Axonemal beta dynein heavy chain 17,Axonemal dynein heavy chain-like protein 1,Ciliary dynein heavy chain 17,Ciliary dynein heavy chain-like protein 1,DNAH17,DNAHL1,DNEL2,Dynein heavy chain 17, axonem
EIAAB43982 Kiaa0644,Leucine-rich repeat-containing protein KIAA0644,Mouse,Mus musculus,TLR4 interactor with leucine rich repeats,Tril
LF-PA40670 anti-Leucine Rich Repeat Containing 1, Rabbit polyclonal to Leucine Rich Repeat Containing 1, Isotype IgG, Host Rabbit 50 ug


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur