Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Dysferlin (Dystrophy-associated fer-1-like protein) (Fer-1-like protein 1)

 DYSF_HUMAN              Reviewed;        2080 AA.
O75923; A0FK00; B1PZ70; B1PZ71; B1PZ72; B1PZ73; B1PZ74; B1PZ75;
B1PZ76; B1PZ77; B1PZ78; B1PZ79; B1PZ80; B1PZ81; B3KQB9; O75696;
Q09EX5; Q0H395; Q53QY3; Q53TD2; Q8TEL8; Q9UEN7;
23-JAN-2002, integrated into UniProtKB/Swiss-Prot.
01-NOV-1998, sequence version 1.
05-JUL-2017, entry version 168.
RecName: Full=Dysferlin;
AltName: Full=Dystrophy-associated fer-1-like protein;
AltName: Full=Fer-1-like protein 1;
Name=DYSF; Synonyms=FER1L1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS MMD1 VAL-1298;
ARG-1857 AND CYS-2042, AND VARIANTS LGMD2B VAL-1298 AND CYS-2042.
TISSUE=Skeletal muscle;
PubMed=9731526; DOI=10.1038/1682;
Liu J., Aoki M., Illa I., Wu C., Fardeau M., Angelini C., Serrano C.,
Urtizberea J.A., Hentati F., Hamida M.B., Bohlega S., Culper E.J.,
Amato A.A., Bossie K., Oeltjen J., Bejaoui K., McKenna-Yasek D.,
Hosler B.A., Schurr E., Arahata K., de Jong P.J., Brown R.H. Jr.;
"Dysferlin, a novel skeletal muscle gene, is mutated in Miyoshi
myopathy and limb girdle muscular dystrophy.";
Nat. Genet. 20:31-36(1998).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 14), AND TISSUE SPECIFICITY.
PubMed=16896923; DOI=10.1007/s00439-006-0230-1;
Pramono Z.A.D., Lai P.S., Tan C.L., Takeda S., Yee W.C.;
"Identification and characterization of a novel human dysferlin
transcript: dysferlin_v1.";
Hum. Genet. 120:410-419(2006).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 2; 3; 4; 5; 6; 7;
8; 9; 10; 11; 12 AND 13), ALTERNATIVE PROMOTER USAGE, AND ALTERNATIVE
SPLICING.
PubMed=19221801; DOI=10.1007/s00439-009-0632-y;
Pramono Z.A., Tan C.L., Seah I.A., See J.S., Kam S.Y., Lai P.S.,
Yee W.C.;
"Identification and characterisation of human dysferlin transcript
variants: implications for dysferlin mutational screening and
isoforms.";
Hum. Genet. 125:413-420(2009).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [MRNA] OF 569-2080 (ISOFORMS 1/2/3/5/8/9/11), AND
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1471-1628 (ISOFORMS
1/2/3/5/8/9/11).
TISSUE=Placenta, and Skeletal muscle;
PubMed=9731527; DOI=10.1038/1689;
Bashir R., Britton S., Strachan T., Keers S., Vafiadaki E., Lako M.,
Richard I., Marchand S., Bourg N., Argov Z., Sadeh M., Mahjneh I.,
Marconi G., Passos-Bueno M.R., de Sa Moreira E., Zatz M.,
Beckmann J.S., Bushby K.M.D.;
"A gene related to Caenorhabditis elegans spermatogenesis factor fer-1
is mutated in limb-girdle muscular dystrophy type 2B.";
Nat. Genet. 20:37-42(1998).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 439-2080 (ISOFORM 15).
TISSUE=Spleen;
Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.;
"The nucleotide sequence of a long cDNA clone isolated from human
spleen.";
Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1497-2080 (ISOFORMS
1/2/3/4/5/6/7/8/9/10/11/12/13/14).
TISSUE=Mammary gland;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[9]
SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE, AND TISSUE SPECIFICITY.
PubMed=10196375; DOI=10.1093/hmg/8.5.855;
Anderson L.V.B., Davison K., Moss J.A., Young C., Cullen M.J.,
Walsh J., Johnson M.A., Bashir R., Britton S., Keers S., Argov Z.,
Mahjneh I., Fougerousse F., Beckmann J.S., Bushby K.M.D.;
"Dysferlin is a plasma membrane protein and is expressed early in
human development.";
Hum. Mol. Genet. 8:855-861(1999).
[10]
ERRATUM.
Anderson L.V.B., Davison K., Moss J.A., Young C., Cullen M.J.,
Walsh J., Johnson M.A., Bashir R., Britton S., Keers S., Argov Z.,
Mahjneh I., Fougerousse F., Beckmann J.S., Bushby K.M.D.;
Hum. Mol. Genet. 8:1141-1141(1999).
[11]
SUBCELLULAR LOCATION.
PubMed=10496277; DOI=10.1212/WNL.53.5.1119;
Matsuda C., Aoki M., Hayashi Y.K., Ho M.F., Arahata K.,
Brown R.H. Jr.;
"Dysferlin is a surface membrane-associated protein that is absent in
Miyoshi myopathy.";
Neurology 53:1119-1122(1999).
[12]
SUBCELLULAR LOCATION, VARIANT MMD1 ARG-791, AND VARIANT LGMD2B
ARG-791.
PubMed=10196377; DOI=10.1093/hmg/8.5.871;
Weiler T., Bashir R., Anderson L.V.B., Davison K., Moss J.A.,
Britton S., Nylen E., Keers S., Vafiadaki E., Greenberg C.R.,
Bushby K.M.D., Wrogemann K.;
"Identical mutation in patients with limb girdle muscular dystrophy
type 2B or Miyoshi myopathy suggests a role for modifier gene(s).";
Hum. Mol. Genet. 8:871-877(1999).
[13]
INVOLVEMENT IN DMAT.
PubMed=11198284;
DOI=10.1002/1531-8249(200101)49:1<130::AID-ANA22>3.0.CO;2-0;
Illa I., Serrano-Munuera C., Gallardo E., Lasa A., Rojas-Garcia R.,
Palmer J., Gallano P., Baiget M., Matsuda C., Brown R.H.;
"Distal anterior compartment myopathy: a dysferlin mutation causing a
new muscular dystrophy phenotype.";
Ann. Neurol. 49:130-134(2001).
[14]
INTERACTION WITH CAV3, AND TISSUE SPECIFICITY.
PubMed=11532985; DOI=10.1093/hmg/10.17.1761;
Matsuda C., Hayashi Y.K., Ogawa M., Aoki M., Murayama K., Nishino I.,
Nonaka I., Arahata K., Brown R.H. Jr.;
"The sarcolemmal proteins dysferlin and caveolin-3 interact in
skeletal muscle.";
Hum. Mol. Genet. 10:1761-1766(2001).
[15]
TISSUE SPECIFICITY, AND CHARACTERIZATION OF VARIANT MMD1 ASP-67.
PubMed=11959863; DOI=10.1074/jbc.M201858200;
Davis D.B., Doherty K.R., Delmonte A.J., McNally E.M.;
"Calcium-sensitive phospholipid binding properties of normal and
mutant ferlin C2 domains.";
J. Biol. Chem. 277:22883-22888(2002).
[16]
TISSUE SPECIFICITY.
PubMed=15318348; DOI=10.1002/mus.20106;
Salani S., Lucchiari S., Fortunato F., Crimi M., Corti S.,
Locatelli F., Bossolasco P., Bresolin N., Comi G.P.;
"Developmental and tissue-specific regulation of a novel dysferlin
isoform.";
Muscle Nerve 30:366-374(2004).
[17]
INTERACTION WITH PARVB, AND SUBCELLULAR LOCATION.
PubMed=15835269;
Matsuda C., Kameyama K., Tagawa K., Ogawa M., Suzuki A., Yamaji S.,
Okamoto H., Nishino I., Hayashi Y.K.;
"Dysferlin interacts with affixin (beta-parvin) at the sarcolemma.";
J. Neuropathol. Exp. Neurol. 64:334-340(2005).
[18]
IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION, AND TISSUE
SPECIFICITY.
PubMed=17554076; DOI=10.1095/biolreprod.107.062190;
Vandre D.D., Ackerman W.E., Kniss D.A., Tewari A.K., Mori M.,
Takizawa T., Robinson J.M.;
"Dysferlin is expressed in human placenta but does not associate with
caveolin.";
Biol. Reprod. 77:533-542(2007).
[19]
INTERACTION WITH AHNAK AND AHNAK2, SUBCELLULAR LOCATION,
CHARACTERIZATION OF VARIANT LGMD2B ASP-67, TISSUE SPECIFICITY, AND
IDENTIFICATION BY MASS SPECTROMETRY.
PubMed=17185750; DOI=10.1096/fj.06-6628com;
Huang Y., Laval S.H., van Remoortere A., Baudier J., Benaud C.,
Anderson L.V., Straub V., Deelder A., Frants R.R., den Dunnen J.T.,
Bushby K., van der Maarel S.M.;
"AHNAK, a novel component of the dysferlin protein complex,
redistributes to the cytoplasm with dysferlin during skeletal muscle
regeneration.";
FASEB J. 21:732-742(2007).
[20]
SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=17363620; DOI=10.1096/fj.06-7659com;
Klinge L., Laval S., Keers S., Haldane F., Straub V., Barresi R.,
Bushby K.;
"From T-tubule to sarcolemma: damage-induced dysferlin translocation
in early myogenesis.";
FASEB J. 21:1768-1776(2007).
[21]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[22]
DOMAIN C2, CALCIUM-BINDING, AND MUTAGENESIS OF ASP-16; ASP-21; ASP-71;
ARG-79 AND PHE-80.
PubMed=24461013; DOI=10.1016/j.bpj.2013.11.4492;
Abdullah N., Padmanarayana M., Marty N.J., Johnson C.P.;
"Quantitation of the calcium and membrane binding properties of the c2
domains of dysferlin.";
Biophys. J. 106:382-389(2014).
[23]
INTERACTION WITH RIPOR2.
PubMed=24687993; DOI=10.1096/fj.13-246470;
Balasubramanian A., Kawahara G., Gupta V.A., Rozkalne A., Beauvais A.,
Kunkel L.M., Gussoni E.;
"Fam65b is important for formation of the HDAC6-dysferlin protein
complex during myogenic cell differentiation.";
FASEB J. 28:2955-2969(2014).
[24]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-166, PHOSPHORYLATION
[LARGE SCALE ANALYSIS] AT SER-167 AND THR-198 (ISOFORMS 11; 13 AND 8),
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-166 AND THR-197
(ISOFORMS 2; 5 AND 7), AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE
SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[25]
X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 942-1052.
PubMed=24438169; DOI=10.1186/1472-6807-14-3;
Sula A., Cole A.R., Yeats C., Orengo C., Keep N.H.;
"Crystal structures of the human Dysferlin inner DysF domain.";
BMC Struct. Biol. 14:3-3(2014).
[26]
X-RAY CRYSTALLOGRAPHY (1.76 ANGSTROMS) OF 1-124 IN COMPLEX WITH
CALCIUM, CALCIUM-BINDING (ISOFORMS 1 AND 14), SUBCELLULAR LOCATION,
DOMAIN, LIPID-BINDING, AND TISSUE SPECIFICITY.
PubMed=24239457; DOI=10.1016/j.str.2013.10.001;
Fuson K., Rice A., Mahling R., Snow A., Nayak K., Shanbhogue P.,
Meyer A.G., Redpath G.M., Hinderliter A., Cooper S.T., Sutton R.B.;
"Alternate splicing of dysferlin C2A confers Ca(2+)-dependent and
Ca(2+)-independent binding for membrane repair.";
Structure 22:104-115(2014).
[27]
VARIANT MMD1 CYS-999.
Matsumura T., Aoki M., Nagano A., Hayashi Y.K., Asada C., Ogawa M.,
Yamanaka G., Goto K., Nakagawa M., Oka H., Sahashi K., Kouhara N.,
Saito Y., Brown R.H. Jr., Nonaka I., Arahata K.;
"Molecular genetic analysis of dysferlin in Japanese patients with
Miyoshi myopathy.";
Proc. Jpn. Acad. 75B:207-212(1999).
[28]
VARIANT MMD1 ASP-67, AND VARIANT LGMD2B ASP-67.
PubMed=11134403; DOI=10.1212/WNL.55.12.1931;
Illarioshkin S.N., Ivanova-Smolenskaya I.A., Greenberg C.R., Nylen E.,
Sukhorukov V.S., Poleshchuk V.V., Markova E.D., Wrogemann K.;
"Identical dysferlin mutation in limb-girdle muscular dystrophy type
2B and distal myopathy.";
Neurology 55:1931-1933(2000).
[29]
VARIANTS MMD1 HIS-1046 AND GLN-2000.
PubMed=11468312; DOI=10.1212/WNL.57.2.271;
Aoki M., Liu J., Richard I., Bashir R., Britton S., Keers S.M.,
Oeltjen J., Brown H.E.V., Marchand S., Bourg N., Beley C.,
McKenna-Yasek D., Arahata K., Bohlega S., Cupler E., Illa I.,
Majneh I., Barohn R.J., Urtizberea J.A., Fardeau M., Amato A.,
Angelini C., Bushby K., Beckmann J.S., Brown R.H. Jr.;
"Genomic organization of the dysferlin gene and novel mutations in
Miyoshi myopathy.";
Neurology 57:271-278(2001).
[30]
VARIANTS MMD1 CYS-999 AND GLU-1679, AND VARIANT HIS-1581.
PubMed=12796534; DOI=10.1212/01.WNL.0000068333.43005.12;
Takahashi T., Aoki M., Tateyama M., Kondo E., Mizuno T., Onodera Y.,
Takano R., Kawai H., Kamakura K., Mochizuki H., Shizuka-Ikeda M.,
Nakagawa M., Yoshida Y., Akanuma J., Hoshino K., Saito H.,
Nishizawa M., Kato S., Saito K., Miyachi T., Yamashita H., Kawai M.,
Matsumura T., Kuzuhara S., Ibi T., Sahashi K., Nakai H., Kohnosu T.,
Nonaka I., Arahata K., Brown R.H. Jr., Saito H., Itoyama Y.;
"Dysferlin mutations in Japanese Miyoshi myopathy: relationship to
phenotype.";
Neurology 60:1799-1804(2003).
[31]
VARIANTS LGMD2B TRP-959; GLN-1038 AND LYS-1335, AND VARIANTS GLN-1022;
ALA-GLU-1065 INS AND LEU-1331.
PubMed=14678801; DOI=10.1016/S0960-8966(03)00133-0;
Cagliani R., Fortunato F., Giorda R., Rodolico C., Bonaglia M.C.,
Sironi M., D'Angelo M.G., Prelle A., Locatelli F., Toscano A.,
Bresolin N., Comi G.P.;
"Molecular analysis of LGMD-2B and MM patients: identification of
novel DYSF mutations and possible founder effect in the Italian
population.";
Neuromuscul. Disord. 13:788-795(2003).
[32]
VARIANTS MMD1 VAL-426 AND LEU-2068.
PubMed=15477515; DOI=10.1001/archneur.61.10.1594;
Ro L.-S., Lee-Chen G.-J., Lin T.-C., Wu Y.-R., Chen C.-M., Lin C.-Y.,
Chen S.-T.;
"Phenotypic features and genetic findings in 2 Chinese families with
Miyoshi distal myopathy.";
Arch. Neurol. 61:1594-1599(2004).
[33]
VARIANTS MMD1 ARG-618; CYS-1041; LYS-1335; ARG-1361 AND ARG-1662,
VARIANTS LGMD2B LYS-1335 AND CYS-1505, AND VARIANTS GLN-1022 AND
ALA-GLU-1065 INS.
PubMed=15469449; DOI=10.1111/j.1468-1331.2004.00755.x;
Kawabe K., Goto K., Nishino I., Angelini C., Hayashi Y.K.;
"Dysferlin mutation analysis in a group of Italian patients with limb-
girdle muscular dystrophy and Miyoshi myopathy.";
Eur. J. Neurol. 11:657-661(2004).
[34]
VARIANTS MMD1 ASP-1842 AND PRO-1922.
PubMed=15116377; DOI=10.1002/mus.20025;
Suzuki N., Aoki M., Takahashi T., Takano D., Asano M., Shiga Y.,
Onodera Y., Tateyama M., Itoyama Y.;
"Novel dysferlin mutations and characteristic muscle atrophy in late-
onset Miyoshi myopathy.";
Muscle Nerve 29:721-723(2004).
[35]
VARIANT MMD1 GLN-389.
PubMed=15515206; DOI=10.3349/ymj.2004.45.5.927;
Oh S.-H., Kim T.-S., Choi Y.-C.;
"Identification of a dysferlin gene mutation in a Korean case with
Miyoshi myopathy.";
Yonsei Med. J. 45:927-930(2004).
[36]
VARIANTS GLU-170 AND TRP-253, VARIANTS LGMD2B TRP-555 AND MET-1208,
VARIANTS MMD1 GLU-299; TRP-456; TRP-555; HIS-1046 AND GLN-1693,
VARIANT PROXIMODISTAL MYOPATHY VAL-1276, VARIANT PSEUDOMETABOLIC
MYOPATHY PRO-266, AND VARIANTS VAL-189; LEU-1331; SER-1351 AND
VAL-1748.
PubMed=16010686; DOI=10.1002/humu.9355;
Nguyen K., Bassez G., Bernard R., Krahn M., Labelle V.,
Figarella-Branger D., Pouget J., Hammouda el H., Beroud C.,
Urtizberea A., Eymard B., Leturcq F., Ben-Yaou R., Levy N.;
"Dysferlin mutations in LGMD2B, Miyoshi myopathy, and atypical
dysferlinopathies.";
Hum. Mutat. 26:165-165(2005).
[37]
ERRATUM.
DOI=10.1002/humu.9388;
Nguyen K., Bassez G., Bernard R., Krahn M., Labelle V.,
Figarella-Branger D., Pouget J., Hammouda el H., Beroud C.,
Urtizberea A., Eymard B., Leturcq F., Levy N.;
Hum. Mutat. 26:592-592(2005).
[38]
VARIANTS MMD1 GLU-170; LEU-374; TRP-959; TRP-1693; ASN-1837 AND
GLY-1942 AND CYS-2042, VARIANTS LGMD2B ARG-621; TRP-959; GLN-1038;
LYS-1335 AND CYS-2042, AND VARIANT SER-1678.
PubMed=16100712; DOI=10.1002/humu.9364;
Cagliani R., Magri F., Toscano A., Merlini L., Fortunato F.,
Lamperti C., Rodolico C., Prelle A., Sironi M., Aguennouz M.,
Ciscato P., Uncini A., Moggio M., Bresolin N., Comi G.P.;
"Mutation finding in patients with dysferlin deficiency and role of
the dysferlin interacting proteins annexin A1 and A2 in muscular
dystrophies.";
Hum. Mutat. 26:283-283(2005).
[39]
VARIANTS LGMD2B ARG-299 AND PRO-1341.
PubMed=16705711; DOI=10.1002/humu.9424;
Wenzel K., Carl M., Perrot A., Zabojszcza J., Assadi M., Ebeling M.,
Geier C., Robinson P.N., Kress W., Osterziel K.-J., Spuler S.;
"Novel sequence variants in dysferlin-deficient muscular dystrophy
leading to mRNA decay and possible C2-domain misfolding.";
Hum. Mutat. 27:599-600(2006).
[40]
VARIANTS LGMD2B ARG-791; CYS-930; TRP-1768 AND CYS-2042, AND VARIANT
ALA-GLU-1065 INS.
PubMed=16996541; DOI=10.1016/j.jns.2006.07.004;
Therrien C., Dodig D., Karpati G., Sinnreich M.;
"Mutation impact on dysferlin inferred from database analysis and
computer-based structural predictions.";
J. Neurol. Sci. 250:71-78(2006).
[41]
VARIANTS [LARGE SCALE ANALYSIS] MET-1325 AND VAL-1349.
PubMed=16959974; DOI=10.1126/science.1133427;
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
Vogelstein B., Kinzler K.W., Velculescu V.E.;
"The consensus coding sequences of human breast and colorectal
cancers.";
Science 314:268-274(2006).
[42]
VARIANTS LGMD2B TYR-625 AND GLY-1734, AND VARIANT MMD1 ARG-519.
PubMed=17287450; DOI=10.1212/01.wnl.0000256768.79353.60;
Illa I., De Luna N., Dominguez-Perles R., Rojas-Garcia R., Paradas C.,
Palmer J., Marquez C., Gallano P., Gallardo E.;
"Symptomatic dysferlin gene mutation carriers: characterization of two
cases.";
Neurology 68:1284-1289(2007).
[43]
VARIANT LGMD2B ARG-299, AND VARIANT MMD1 TRP-299.
PubMed=18306167; DOI=10.1002/ana.21309;
Spuler S., Carl M., Zabojszcza J., Straub V., Bushby K., Moore S.A.,
Baehring S., Wenzel K., Vinkemeier U., Rocken C.;
"Dysferlin-deficient muscular dystrophy features amyloidosis.";
Ann. Neurol. 63:323-328(2008).
[44]
VARIANTS LGMD2B ARG-52; ARG-155; GLU-170; GLU-234; THR-284; TRP-555;
ARG-618; ARG-731; CYS-930; GLN-1022; PRO-1228; THR-1526; ASP-1543;
TRP-1768; SER-1970 AND CYS-2042, VARIANTS MMD1 GLU-299;
386-PHE--ASP-390 DELINS TYR; ARG-426; TRP-456; TRP-555; LEU-1029;
HIS-1046; HIS-1046; GLN-1693; 1938-THR-ALA-1939 DEL AND CYS-2042,
VARIANTS GLU-170; TRP-253 AND TRP-555, VARIANTS PROXIMODISTAL MYOPATHY
ARG-299; ARG-340; VAL-1748; TRP-1768 AND CYS-2042, VARIANT
PSEUDOMETABOLIC MYOPATHY PRO-266, AND VARIANTS VAL-84; VAL-189;
ALA-335; LEU-374; ASN-390; GLN-819; GLN-1038; VAL-1276; VAL-1325;
ASN-1837 AND SER-1967.
PubMed=18853459; DOI=10.1002/humu.20910;
Krahn M., Beroud C., Labelle V., Nguyen K., Bernard R., Bassez G.,
Figarella-Branger D., Fernandez C., Bouvenot J., Richard I.,
Ollagnon-Roman E., Bevilacqua J.A., Salvo E., Attarian S., Chapon F.,
Pellissier J.-F., Pouget J., Hammouda el H., Laforet P.,
Urtizberea J.A., Eymard B., Leturcq F., Levy N.;
"Analysis of the DYSF mutational spectrum in a large cohort of
patients.";
Hum. Mutat. 30:E345-E375(2009).
-!- FUNCTION: Key calcium ion sensor involved in the Ca(2+)-triggered
synaptic vesicle-plasma membrane fusion. Plays a role in the
sarcolemma repair mechanism of both skeletal muscle and
cardiomyocytes that permits rapid resealing of membranes disrupted
by mechanical stress (By similarity). {ECO:0000250}.
-!- SUBUNIT: Interacts with CACNA1S. Interacts with ANXA1; the
interaction is Ca(2+)- and injury state-dependent. Interacts with
ANXA2; the interaction is Ca(2+)- and injury state-dependent.
Interacts with CACNA1S and PARVB. Interacts with TRIM72/MG53;
interaction is required for transport to sites of cell injury
during repair patch formation (By similarity). Interacts with
RIPOR2; this interaction occurs during early myogenic
differentiation (PubMed:24687993). Interacts with CAV3 and PARVB.
Interacts with AHNAK; the interaction is direct and Ca(2+)-
independent. Interacts with AHNAK2; the interaction is direct and
Ca(2+)-independent. {ECO:0000250, ECO:0000269|PubMed:11532985,
ECO:0000269|PubMed:15835269, ECO:0000269|PubMed:17185750,
ECO:0000269|PubMed:24239457, ECO:0000269|PubMed:24687993}.
-!- INTERACTION:
P35609:ACTN2; NbExp=2; IntAct=EBI-2799016, EBI-77797;
Q8TCU4:ALMS1; NbExp=3; IntAct=EBI-2799016, EBI-308651;
Q9UKG1:APPL1; NbExp=2; IntAct=EBI-2799016, EBI-741243;
Q8N3K9:CMYA5; NbExp=3; IntAct=EBI-2799016, EBI-2323272;
P17661:DES; NbExp=3; IntAct=EBI-2799016, EBI-1055572;
Q16760:DGKD; NbExp=3; IntAct=EBI-2799016, EBI-719333;
O75190:DNAJB6; NbExp=2; IntAct=EBI-2799016, EBI-1053164;
Q14315:FLNC; NbExp=3; IntAct=EBI-2799016, EBI-489954;
Q00872:MYBPC1; NbExp=4; IntAct=EBI-2799016, EBI-5652924;
P52179:MYOM1; NbExp=3; IntAct=EBI-2799016, EBI-5353249;
P54296:MYOM2; NbExp=3; IntAct=EBI-2799016, EBI-5357134;
P20929:NEB; NbExp=6; IntAct=EBI-2799016, EBI-1049657;
Q96CV9:OPTN; NbExp=3; IntAct=EBI-2799016, EBI-748974;
Q9Y3Z3:SAMHD1; NbExp=2; IntAct=EBI-2799016, EBI-1054601;
Q13326:SGCG; NbExp=3; IntAct=EBI-2799016, EBI-5357343;
O95295:SNAPIN; NbExp=3; IntAct=EBI-2799016, EBI-296723;
Q8WZ42:TTN; NbExp=17; IntAct=EBI-2799016, EBI-681210;
-!- SUBCELLULAR LOCATION: Cell membrane, sarcolemma; Single-pass type
II membrane protein. Cytoplasmic vesicle membrane {ECO:0000250};
Single-pass type II membrane protein {ECO:0000250}. Cell membrane.
Note=Colocalizes, during muscle differentiation, with BIN1 in the
T-tubule system of myotubules and at the site of contact between
two myotubes or a myoblast and a myotube. Wounding of myotubes led
to its focal enrichment to the site of injury and to its
relocalization in a Ca(2+)-dependent manner toward the plasma
membrane. Colocalizes with AHNAK, AHNAK2 and PARVB at the
sarcolemma of skeletal muscle. Detected on the apical plasma
membrane of the syncytiotrophoblast. Reaches the plasmma membrane
through a caveolin-independent mechanism. Retained by caveolin at
the plasmma membrane (By similarity). Colocalizes, during muscle
differentiation, with CACNA1S in the T-tubule system of myotubules
(By similarity). Accumulates and colocalizes with fusion vesicles
at the sarcolemma disruption sites (By similarity). {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative promoter usage, Alternative splicing; Named isoforms=15;
Comment=Approximately 23% of the transcripts in skeletal muscle
incorporate exon 1a from an alternative promoter and missing the
calcium-binding sites of domain C2 1.;
Name=1;
IsoId=O75923-1; Sequence=Displayed;
Name=2;
IsoId=O75923-2; Sequence=VSP_035925;
Note=Contains a phosphoserine at position 166. Contains a
phosphothreonine at position 197. {ECO:0000244|PubMed:24275569};
Name=3;
IsoId=O75923-3; Sequence=VSP_035926;
Name=4;
IsoId=O75923-4; Sequence=VSP_035927;
Name=5;
IsoId=O75923-5; Sequence=VSP_035925, VSP_035926;
Note=Contains a phosphoserine at position 166. Contains a
phosphothreonine at position 197. {ECO:0000244|PubMed:24275569};
Name=6;
IsoId=O75923-6; Sequence=VSP_035926, VSP_035927;
Name=7;
IsoId=O75923-7; Sequence=VSP_035925, VSP_035926, VSP_035927;
Note=Contains a phosphoserine at position 166. Contains a
phosphothreonine at position 197. {ECO:0000244|PubMed:24275569};
Name=8;
IsoId=O75923-8; Sequence=VSP_035924, VSP_035925;
Note=Contains a phosphoserine at position 167. Contains a
phosphothreonine at position 198. {ECO:0000244|PubMed:24275569};
Name=9;
IsoId=O75923-9; Sequence=VSP_035924, VSP_035926;
Name=10;
IsoId=O75923-10; Sequence=VSP_035924, VSP_035927;
Name=11;
IsoId=O75923-11; Sequence=VSP_035924, VSP_035925, VSP_035926;
Note=Contains a phosphoserine at position 167. Contains a
phosphothreonine at position 198. {ECO:0000244|PubMed:24275569};
Name=12;
IsoId=O75923-12; Sequence=VSP_035924, VSP_035926, VSP_035927;
Name=13;
IsoId=O75923-13; Sequence=VSP_035924, VSP_035925, VSP_035926,
VSP_035927;
Note=Contains a phosphoserine at position 167. Contains a
phosphothreonine at position 198. {ECO:0000244|PubMed:24275569};
Name=14; Synonyms=Dysferlin_v1, DYSF_v1;
IsoId=O75923-14; Sequence=VSP_035924;
Note=Produced by alternative promoter usage.;
Name=15;
IsoId=O75923-15; Sequence=VSP_035926, VSP_035928, VSP_035929;
-!- TISSUE SPECIFICITY: Expressed in skeletal muscle, myoblast,
myotube and in the syncytiotrophoblast (STB) of the placenta (at
protein level). Ubiquitous. Highly expressed in skeletal muscle.
Also found in heart, brain, spleen, intestine, placenta and at
lower levels in liver, lung, kidney and pancreas.
{ECO:0000269|PubMed:10196375, ECO:0000269|PubMed:11532985,
ECO:0000269|PubMed:11959863, ECO:0000269|PubMed:15318348,
ECO:0000269|PubMed:16896923, ECO:0000269|PubMed:17185750,
ECO:0000269|PubMed:17363620, ECO:0000269|PubMed:17554076,
ECO:0000269|PubMed:24239457}.
-!- DEVELOPMENTAL STAGE: Expression in limb tissue from 5-6 weeks
embryos; persists throughout development.
{ECO:0000269|PubMed:10196375}.
-!- DOMAIN: All seven C2 domains associate with lipid membranes in a
calcium-dependent manner. Domains C2 1 and 3 have the highest
affinity for calcium, the C2 domain 1 seems to be largely
unstructured in the absence of bound ligands. The C2 domain 1 from
isoform 14 does not bind calcium in the absence of bound
phospholipid (PubMed:24239457, PubMed:24461013).
{ECO:0000269|PubMed:24239457, ECO:0000269|PubMed:24461013}.
-!- DISEASE: Limb-girdle muscular dystrophy 2B (LGMD2B) [MIM:253601]:
An autosomal recessive degenerative myopathy characterized by
weakness and atrophy starting in the proximal pelvifemoral
muscles, with onset in the late teens or later, massive elevation
of serum creatine kinase levels and slow progression. Scapular
muscle involvement is minor and not present at onset. Upper limb
girdle involvement follows some years after the onset in lower
limbs. {ECO:0000269|PubMed:10196377, ECO:0000269|PubMed:11134403,
ECO:0000269|PubMed:14678801, ECO:0000269|PubMed:15469449,
ECO:0000269|PubMed:16010686, ECO:0000269|PubMed:16100712,
ECO:0000269|PubMed:16705711, ECO:0000269|PubMed:16996541,
ECO:0000269|PubMed:17185750, ECO:0000269|PubMed:17287450,
ECO:0000269|PubMed:18306167, ECO:0000269|PubMed:18853459,
ECO:0000269|PubMed:9731526}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Miyoshi muscular dystrophy 1 (MMD1) [MIM:254130]: A late-
onset muscular dystrophy involving the distal lower limb
musculature. It is characterized by weakness that initially
affects the gastrocnemius muscle during early adulthood.
{ECO:0000269|PubMed:10196377, ECO:0000269|PubMed:11134403,
ECO:0000269|PubMed:11468312, ECO:0000269|PubMed:11959863,
ECO:0000269|PubMed:12796534, ECO:0000269|PubMed:15116377,
ECO:0000269|PubMed:15469449, ECO:0000269|PubMed:15477515,
ECO:0000269|PubMed:15515206, ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:16100712, ECO:0000269|PubMed:17287450,
ECO:0000269|PubMed:18306167, ECO:0000269|PubMed:18853459,
ECO:0000269|PubMed:9731526, ECO:0000269|Ref.27}. Note=The disease
is caused by mutations affecting the gene represented in this
entry.
-!- DISEASE: Distal myopathy with anterior tibial onset (DMAT)
[MIM:606768]: Onset of the disorder is between 14 and 28 years of
age and the anterior tibial muscles are the first muscle group to
be involved. Inheritance is autosomal recessive.
{ECO:0000269|PubMed:11198284}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the ferlin family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAG51981.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=CAA07603.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Sequence=CAA07603.1; Type=Frameshift; Positions=1972; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Leiden Muscular Dystrophy pages;
Note=Dysferlin;
URL="http://www.dmd.nl/dysf_home.html";
-!- WEB RESOURCE: Name=Wikipedia; Note=Dysferlin entry;
URL="https://en.wikipedia.org/wiki/Dysferlin";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF075575; AAC63519.1; -; mRNA.
EMBL; DQ267935; ABB89736.1; -; mRNA.
EMBL; DQ976379; ABI75150.1; -; Genomic_DNA.
EMBL; EF015906; ABK20181.1; -; Genomic_DNA.
EMBL; EU515155; ACB12752.1; -; mRNA.
EMBL; EU515156; ACB12753.1; -; mRNA.
EMBL; EU515157; ACB12754.1; -; mRNA.
EMBL; EU515158; ACB12755.1; -; mRNA.
EMBL; EU515159; ACB12756.1; -; mRNA.
EMBL; EU515160; ACB12757.1; -; mRNA.
EMBL; EU515161; ACB12758.1; -; mRNA.
EMBL; EU515162; ACB12759.1; -; mRNA.
EMBL; EU515163; ACB12760.1; -; mRNA.
EMBL; EU515164; ACB12761.1; -; mRNA.
EMBL; EU515165; ACB12762.1; -; mRNA.
EMBL; EU515166; ACB12763.1; -; mRNA.
EMBL; AC010147; AAY14954.1; -; Genomic_DNA.
EMBL; AC104084; AAY24199.1; -; Genomic_DNA.
EMBL; CH471053; EAW99763.1; -; Genomic_DNA.
EMBL; AJ007670; CAA07603.1; ALT_SEQ; mRNA.
EMBL; AJ007973; CAA07800.1; -; Genomic_DNA.
EMBL; AK074104; BAB84930.1; -; mRNA.
EMBL; AK074649; BAG51981.1; ALT_INIT; mRNA.
CCDS; CCDS1918.1; -. [O75923-1]
CCDS; CCDS46323.1; -. [O75923-2]
CCDS; CCDS46324.1; -. [O75923-7]
CCDS; CCDS46325.1; -. [O75923-5]
CCDS; CCDS46326.1; -. [O75923-4]
CCDS; CCDS46327.1; -. [O75923-8]
CCDS; CCDS46328.1; -. [O75923-13]
CCDS; CCDS46329.1; -. [O75923-11]
CCDS; CCDS46330.1; -. [O75923-10]
CCDS; CCDS46331.1; -. [O75923-14]
CCDS; CCDS46332.1; -. [O75923-12]
RefSeq; NP_001123927.1; NM_001130455.1. [O75923-14]
RefSeq; NP_001124448.1; NM_001130976.1. [O75923-3]
RefSeq; NP_001124449.1; NM_001130977.1. [O75923-6]
RefSeq; NP_001124450.1; NM_001130978.1. [O75923-4]
RefSeq; NP_001124451.1; NM_001130979.1. [O75923-2]
RefSeq; NP_001124452.1; NM_001130980.1. [O75923-5]
RefSeq; NP_001124453.1; NM_001130981.1. [O75923-7]
RefSeq; NP_001124454.1; NM_001130982.1. [O75923-8]
RefSeq; NP_001124455.1; NM_001130983.1. [O75923-10]
RefSeq; NP_001124456.1; NM_001130984.1. [O75923-12]
RefSeq; NP_001124457.1; NM_001130985.1. [O75923-11]
RefSeq; NP_001124458.1; NM_001130986.1. [O75923-9]
RefSeq; NP_001124459.1; NM_001130987.1. [O75923-13]
RefSeq; NP_003485.1; NM_003494.3. [O75923-1]
UniGene; Hs.252180; -.
PDB; 4CAH; X-ray; 1.90 A; B=942-1052.
PDB; 4CAI; X-ray; 2.20 A; A/B/C=942-1052.
PDB; 4IHB; X-ray; 2.04 A; A/B/C/D/E/F=1-124.
PDB; 4IQH; X-ray; 1.76 A; A/B/C=28-124.
PDBsum; 4CAH; -.
PDBsum; 4CAI; -.
PDBsum; 4IHB; -.
PDBsum; 4IQH; -.
ProteinModelPortal; O75923; -.
SMR; O75923; -.
BioGrid; 113896; 10.
IntAct; O75923; 50.
STRING; 9606.ENSP00000386881; -.
TCDB; 1.F.1.2.1; the synaptosomal vesicle fusion pore (svf-pore) family.
iPTMnet; O75923; -.
PhosphoSitePlus; O75923; -.
BioMuta; DYSF; -.
EPD; O75923; -.
MaxQB; O75923; -.
PaxDb; O75923; -.
PeptideAtlas; O75923; -.
PRIDE; O75923; -.
Ensembl; ENST00000258104; ENSP00000258104; ENSG00000135636. [O75923-1]
Ensembl; ENST00000394120; ENSP00000377678; ENSG00000135636. [O75923-14]
Ensembl; ENST00000409366; ENSP00000386512; ENSG00000135636. [O75923-10]
Ensembl; ENST00000409582; ENSP00000386547; ENSG00000135636. [O75923-7]
Ensembl; ENST00000409651; ENSP00000386683; ENSG00000135636. [O75923-8]
Ensembl; ENST00000409744; ENSP00000386285; ENSG00000135636. [O75923-12]
Ensembl; ENST00000409762; ENSP00000387137; ENSG00000135636. [O75923-5]
Ensembl; ENST00000410020; ENSP00000386881; ENSG00000135636. [O75923-13]
Ensembl; ENST00000410041; ENSP00000386617; ENSG00000135636. [O75923-11]
Ensembl; ENST00000413539; ENSP00000407046; ENSG00000135636. [O75923-2]
Ensembl; ENST00000429174; ENSP00000398305; ENSG00000135636. [O75923-4]
GeneID; 8291; -.
KEGG; hsa:8291; -.
UCSC; uc002sie.4; human. [O75923-1]
CTD; 8291; -.
DisGeNET; 8291; -.
GeneCards; DYSF; -.
GeneReviews; DYSF; -.
HGNC; HGNC:3097; DYSF.
HPA; CAB002510; -.
HPA; HPA017071; -.
HPA; HPA021945; -.
MalaCards; DYSF; -.
MIM; 253601; phenotype.
MIM; 254130; phenotype.
MIM; 603009; gene.
MIM; 606768; phenotype.
neXtProt; NX_O75923; -.
OpenTargets; ENSG00000135636; -.
Orphanet; 268; Autosomal recessive limb-girdle muscular dystrophy type 2B.
Orphanet; 199329; Congenital myopathy, Paradas type.
Orphanet; 178400; Distal myopathy with anterior tibial onset.
Orphanet; 45448; Miyoshi myopathy.
PharmGKB; PA27554; -.
eggNOG; KOG1326; Eukaryota.
eggNOG; ENOG410XPT2; LUCA.
GeneTree; ENSGT00550000074414; -.
HOVERGEN; HBG018972; -.
InParanoid; O75923; -.
KO; K18261; -.
OMA; SSYWEDI; -.
OrthoDB; EOG091G00N6; -.
PhylomeDB; O75923; -.
TreeFam; TF316871; -.
Reactome; R-HSA-445355; Smooth Muscle Contraction.
SIGNOR; O75923; -.
ChiTaRS; DYSF; human.
GeneWiki; Dysferlin; -.
GenomeRNAi; 8291; -.
PRO; PR:O75923; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000135636; -.
Genevisible; O75923; HS.
GO; GO:0030659; C:cytoplasmic vesicle membrane; TAS:Reactome.
GO; GO:0005769; C:early endosome; IDA:UniProtKB.
GO; GO:0030139; C:endocytic vesicle; IDA:UniProtKB.
GO; GO:0005768; C:endosome; IDA:UniProtKB.
GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0030027; C:lamellipodium; IEA:Ensembl.
GO; GO:0005770; C:late endosome; IDA:UniProtKB.
GO; GO:0005815; C:microtubule organizing center; IDA:HPA.
GO; GO:0005886; C:plasma membrane; IDA:UniProtKB.
GO; GO:0042383; C:sarcolemma; IDA:UniProtKB.
GO; GO:0030315; C:T-tubule; IDA:UniProtKB.
GO; GO:0005509; F:calcium ion binding; IDA:UniProtKB.
GO; GO:0005544; F:calcium-dependent phospholipid binding; IMP:UniProtKB.
GO; GO:0005543; F:phospholipid binding; IDA:UniProtKB.
GO; GO:0006936; P:muscle contraction; TAS:Reactome.
GO; GO:0001778; P:plasma membrane repair; IEA:Ensembl.
GO; GO:0006906; P:vesicle fusion; IEA:Ensembl.
Gene3D; 2.60.40.150; -; 7.
InterPro; IPR000008; C2_dom.
InterPro; IPR029998; Dysferlin.
InterPro; IPR012968; FerIin_dom.
InterPro; IPR012560; Ferlin_A-domain.
InterPro; IPR012561; Ferlin_B-domain.
InterPro; IPR032362; Ferlin_C.
InterPro; IPR006614; Peroxin/Ferlin.
PANTHER; PTHR12546:SF53; PTHR12546:SF53; 1.
Pfam; PF00168; C2; 7.
Pfam; PF08165; FerA; 1.
Pfam; PF08150; FerB; 1.
Pfam; PF08151; FerI; 1.
Pfam; PF16165; Ferlin_C; 1.
SMART; SM00239; C2; 7.
SMART; SM00694; DysFC; 2.
SMART; SM00693; DysFN; 2.
SMART; SM01200; FerA; 1.
SMART; SM01201; FerB; 1.
SMART; SM01202; FerI; 1.
SUPFAM; SSF49562; SSF49562; 8.
PROSITE; PS50004; C2; 5.
1: Evidence at protein level;
3D-structure; Alternative promoter usage; Alternative splicing;
Calcium; Cell membrane; Complete proteome; Cytoplasmic vesicle;
Disease mutation; Limb-girdle muscular dystrophy; Lipid-binding;
Membrane; Metal-binding; Phosphoprotein; Polymorphism;
Reference proteome; Repeat; Signal-anchor; Transmembrane;
Transmembrane helix.
CHAIN 1 2080 Dysferlin.
/FTId=PRO_0000057879.
TOPO_DOM 1 2046 Cytoplasmic. {ECO:0000255}.
TRANSMEM 2047 2067 Helical. {ECO:0000255}.
TOPO_DOM 2068 2080 Extracellular. {ECO:0000255}.
DOMAIN 1 85 C2 1. {ECO:0000255|PROSITE-
ProRule:PRU00041}.
DOMAIN 207 302 C2 2. {ECO:0000255|PROSITE-
ProRule:PRU00041}.
DOMAIN 366 479 C2 3. {ECO:0000255|PROSITE-
ProRule:PRU00041}.
DOMAIN 1139 1244 C2 4. {ECO:0000255|PROSITE-
ProRule:PRU00041}.
DOMAIN 1336 1423 C2 5. {ECO:0000255|PROSITE-
ProRule:PRU00041}.
DOMAIN 1565 1663 C2 6. {ECO:0000255|PROSITE-
ProRule:PRU00041}.
DOMAIN 1813 1926 C2 7. {ECO:0000255|PROSITE-
ProRule:PRU00041}.
COMPBIAS 1038 1097 Arg-rich.
METAL 18 18 Calcium. {ECO:0000269|PubMed:24239457}.
METAL 19 19 Calcium; via carbonyl oxygen.
{ECO:0000269|PubMed:24239457}.
METAL 21 21 Calcium. {ECO:0000269|PubMed:24239457}.
METAL 40 40 Calcium. {ECO:0000269|PubMed:24239457}.
MOD_RES 166 166 Phosphothreonine.
{ECO:0000244|PubMed:24275569}.
VAR_SEQ 1 29 MLRVFILYAENVHTPDTDISDAYCSAVFA -> MLCCLLVR
ASNLPSAKKDRRSDPVASLTFR (in isoform 8,
isoform 9, isoform 10, isoform 11,
isoform 12, isoform 13 and isoform 14).
{ECO:0000303|PubMed:16896923,
ECO:0000303|PubMed:19221801}.
/FTId=VSP_035924.
VAR_SEQ 152 152 A -> AGGGQSRAETWSLLSDSTMDTRYSGKKWPAPT (in
isoform 2, isoform 5, isoform 7, isoform
8, isoform 11 and isoform 13).
{ECO:0000303|PubMed:19221801}.
/FTId=VSP_035925.
VAR_SEQ 494 508 EEPAGAVKPSKASDL -> V (in isoform 3,
isoform 5, isoform 6, isoform 7, isoform
9, isoform 11, isoform 12, isoform 13 and
isoform 15).
{ECO:0000303|PubMed:19221801,
ECO:0000303|Ref.7}.
/FTId=VSP_035926.
VAR_SEQ 1470 1470 Q -> QLADGLSSLAPTNTASPPSSPH (in isoform
4, isoform 6, isoform 7, isoform 10,
isoform 12 and isoform 13).
{ECO:0000303|PubMed:19221801}.
/FTId=VSP_035927.
VAR_SEQ 1934 1968 KPAKTAKKCSLDQLDDAFHPEWFVSLFEQKTVKGW -> SS
ASSSRPPRPDCPARVGRQTDGPAHTPRVANMEL (in
isoform 15). {ECO:0000303|Ref.7}.
/FTId=VSP_035928.
VAR_SEQ 1969 2080 Missing (in isoform 15).
{ECO:0000303|Ref.7}.
/FTId=VSP_035929.
VARIANT 52 52 W -> R (in LGMD2B).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057834.
VARIANT 67 67 V -> D (in MMD1 and LGMD2B; Reduces
calcium-sensitive phospholipid binding
and interaction with AHNAK and AHNAK2;
dbSNP:rs121908957).
{ECO:0000269|PubMed:11134403,
ECO:0000269|PubMed:11959863,
ECO:0000269|PubMed:17185750}.
/FTId=VAR_057835.
VARIANT 84 84 A -> V (in dbSNP:rs772008300).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057836.
VARIANT 155 155 G -> R (in LGMD2B; dbSNP:rs200970855).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057837.
VARIANT 170 170 A -> E (in MMD1 and LGMD2B; also found in
patients with isolated hyperCKemia;
dbSNP:rs34999029).
{ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:16100712,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024853.
VARIANT 189 189 L -> V (in dbSNP:rs13407355).
{ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024854.
VARIANT 234 234 G -> E (in LGMD2B; dbSNP:rs141497053).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057838.
VARIANT 253 253 R -> W (found in patients with isolated
hyperCKemia; dbSNP:rs149827237).
{ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024855.
VARIANT 266 266 L -> P (in pseudometabolic myopathy).
{ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024856.
VARIANT 284 284 I -> T (in LGMD2B).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057839.
VARIANT 299 299 G -> E (in MMD1).
{ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024857.
VARIANT 299 299 G -> R (in LGMD2B and proximodistal
myopathy; dbSNP:rs121908963).
{ECO:0000269|PubMed:16705711,
ECO:0000269|PubMed:18306167,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_057840.
VARIANT 299 299 G -> W (in MMD1; dbSNP:rs121908963).
{ECO:0000269|PubMed:18306167}.
/FTId=VAR_057841.
VARIANT 335 335 G -> A. {ECO:0000269|PubMed:18853459}.
/FTId=VAR_057842.
VARIANT 340 340 S -> R (in proximodistal myopathy).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057843.
VARIANT 374 374 V -> L (in MMD1; unknown pathological
significance; dbSNP:rs150724610).
{ECO:0000269|PubMed:16100712,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_057844.
VARIANT 386 390 FRAED -> Y (in MMD1).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057845.
VARIANT 389 389 E -> Q (in MMD1).
{ECO:0000269|PubMed:15515206}.
/FTId=VAR_057846.
VARIANT 390 390 D -> N. {ECO:0000269|PubMed:18853459}.
/FTId=VAR_057847.
VARIANT 426 426 G -> R (in MMD1).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057848.
VARIANT 426 426 G -> V (in MMD1).
{ECO:0000269|PubMed:15477515}.
/FTId=VAR_057849.
VARIANT 456 456 C -> W (in MMD1).
{ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024858.
VARIANT 519 519 G -> R (in MMD1; dbSNP:rs121908962).
{ECO:0000269|PubMed:17287450}.
/FTId=VAR_057850.
VARIANT 555 555 R -> W (in LGMD2B and MMD1; also found in
patients with isolated hyperCKemia;
dbSNP:rs377735262).
{ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024859.
VARIANT 618 618 G -> R (in MMD1 and LGMD2B;
dbSNP:rs201049092).
{ECO:0000269|PubMed:15469449,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_057851.
VARIANT 621 621 G -> R (in LGMD2B).
{ECO:0000269|PubMed:16100712}.
/FTId=VAR_057852.
VARIANT 625 625 D -> Y (in LGMD2B; dbSNP:rs121908960).
{ECO:0000269|PubMed:17287450}.
/FTId=VAR_057853.
VARIANT 731 731 P -> R (in LGMD2B).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057854.
VARIANT 791 791 P -> R (in MMD1 and LGMD2B;
dbSNP:rs121908956).
{ECO:0000269|PubMed:10196377,
ECO:0000269|PubMed:16996541}.
/FTId=VAR_012308.
VARIANT 819 819 R -> Q (in dbSNP:rs748636047).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057855.
VARIANT 834 834 I -> V (in dbSNP:rs34671418).
/FTId=VAR_049055.
VARIANT 930 930 W -> C (in LGMD2B; unknown pathological
significance; dbSNP:rs727503910).
{ECO:0000269|PubMed:16996541,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_057856.
VARIANT 959 959 R -> W (in MMD1 and LGMD2B;
dbSNP:rs202218890).
{ECO:0000269|PubMed:14678801,
ECO:0000269|PubMed:16100712}.
/FTId=VAR_024860.
VARIANT 999 999 W -> C (in MMD1; dbSNP:rs28937581).
{ECO:0000269|PubMed:12796534,
ECO:0000269|Ref.27}.
/FTId=VAR_057857.
VARIANT 1022 1022 R -> Q (in LGMD2B; unknown pathological
significance; dbSNP:rs34211915).
{ECO:0000269|PubMed:14678801,
ECO:0000269|PubMed:15469449,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024861.
VARIANT 1029 1029 P -> L (in MMD1).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057858.
VARIANT 1038 1038 R -> Q (in LGMD2B; unknown pathological
significance; dbSNP:rs150877497).
{ECO:0000269|PubMed:14678801,
ECO:0000269|PubMed:16100712,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024862.
VARIANT 1041 1041 R -> C (in MMD1; dbSNP:rs144598063).
{ECO:0000269|PubMed:15469449}.
/FTId=VAR_057859.
VARIANT 1046 1046 R -> H (in MMD1; dbNP:28939700;
dbSNP:rs28939700).
{ECO:0000269|PubMed:11468312,
ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024863.
VARIANT 1065 1065 E -> EAE. {ECO:0000269|PubMed:16996541}.
/FTId=VAR_024864.
VARIANT 1072 1072 A -> P (in dbSNP:rs34660230).
/FTId=VAR_049056.
VARIANT 1096 1096 R -> H (in dbSNP:rs59915619).
/FTId=VAR_061170.
VARIANT 1208 1208 I -> M (in LGMD2B; dbSNP:rs148858485).
{ECO:0000269|PubMed:16010686}.
/FTId=VAR_024865.
VARIANT 1228 1228 L -> P (in LGMD2B).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057860.
VARIANT 1242 1242 R -> H (in dbSNP:rs2303603).
/FTId=VAR_020308.
VARIANT 1276 1276 L -> V (in proximodistal myopathy).
{ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024866.
VARIANT 1298 1298 I -> V (in MMD1 and LGMD2B;
dbSNP:rs121908954).
{ECO:0000269|PubMed:9731526}.
/FTId=VAR_012309.
VARIANT 1325 1325 I -> M (in a breast cancer sample;
somatic mutation).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_035893.
VARIANT 1325 1325 I -> V (in dbSNP:rs145401010).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057861.
VARIANT 1331 1331 R -> L (in dbSNP:rs61742872).
{ECO:0000269|PubMed:14678801,
ECO:0000269|PubMed:16010686}.
/FTId=VAR_024867.
VARIANT 1335 1335 E -> K (in MMD1 and LGMD2B;
dbSNP:rs758993965).
{ECO:0000269|PubMed:14678801,
ECO:0000269|PubMed:15469449,
ECO:0000269|PubMed:16100712}.
/FTId=VAR_024868.
VARIANT 1341 1341 L -> P (in LGMD2B; dbSNP:rs757917335).
{ECO:0000269|PubMed:16705711}.
/FTId=VAR_057862.
VARIANT 1349 1349 L -> V (in a breast cancer sample;
somatic mutation).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_035894.
VARIANT 1351 1351 N -> S (in dbSNP:rs139529811).
{ECO:0000269|PubMed:16010686}.
/FTId=VAR_024869.
VARIANT 1361 1361 C -> R (in MMD1; dbSNP:rs776472879).
{ECO:0000269|PubMed:15469449}.
/FTId=VAR_057863.
VARIANT 1505 1505 Y -> C (in LGMD2B; dbSNP:rs757820496).
{ECO:0000269|PubMed:15469449}.
/FTId=VAR_057864.
VARIANT 1526 1526 K -> T (in LGMD2B; dbSNP:rs76086153).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057865.
VARIANT 1543 1543 G -> D (in LGMD2B).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057866.
VARIANT 1581 1581 R -> H (in dbSNP:rs185596534).
{ECO:0000269|PubMed:12796534}.
/FTId=VAR_057867.
VARIANT 1662 1662 T -> R (in MMD1).
{ECO:0000269|PubMed:15469449}.
/FTId=VAR_057868.
VARIANT 1678 1678 C -> S (found in patients with isolated
hyperCKemia; dbSNP:rs753279446).
{ECO:0000269|PubMed:16100712}.
/FTId=VAR_057869.
VARIANT 1679 1679 G -> E (in MMD1).
{ECO:0000269|PubMed:12796534}.
/FTId=VAR_057870.
VARIANT 1693 1693 R -> Q (in MMD1; dbSNP:rs779987458).
{ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024870.
VARIANT 1693 1693 R -> W (in MMD1; dbSNP:rs863225021).
{ECO:0000269|PubMed:16100712}.
/FTId=VAR_057871.
VARIANT 1734 1734 E -> G (in LGMD2B; dbSNP:rs121908961).
{ECO:0000269|PubMed:17287450}.
/FTId=VAR_057872.
VARIANT 1748 1748 E -> V (in proximodistal myopathy).
{ECO:0000269|PubMed:16010686,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_024871.
VARIANT 1768 1768 R -> W (in LGMD2B and proximodistal
myopathy; unknown pathological
significance; dbSNP:rs746243052).
{ECO:0000269|PubMed:16996541,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_057873.
VARIANT 1837 1837 D -> N (in MMD1; dbSNP:rs398123794).
{ECO:0000269|PubMed:16100712,
ECO:0000269|PubMed:18853459}.
/FTId=VAR_057874.
VARIANT 1842 1842 G -> D (in MMD1).
{ECO:0000269|PubMed:15116377}.
/FTId=VAR_057875.
VARIANT 1857 1857 H -> R (in MMD1; dbSNP:rs199601326).
{ECO:0000269|PubMed:9731526}.
/FTId=VAR_012310.
VARIANT 1922 1922 L -> P (in MMD1).
{ECO:0000269|PubMed:15116377}.
/FTId=VAR_057876.
VARIANT 1938 1939 Missing (in MMD1).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057877.
VARIANT 1942 1942 C -> G (in MMD1).
{ECO:0000269|PubMed:16100712}.
/FTId=VAR_057878.
VARIANT 1967 1967 G -> S. {ECO:0000269|PubMed:18853459}.
/FTId=VAR_057879.
VARIANT 1970 1970 P -> S (in LGMD2B).
{ECO:0000269|PubMed:18853459}.
/FTId=VAR_057880.
VARIANT 2000 2000 R -> Q (in MMD1; dbSNP:rs115407852).
{ECO:0000269|PubMed:11468312}.
/FTId=VAR_024872.
VARIANT 2042 2042 R -> C (in MMD1, LGMD2B and proximodistal
myopathy; dbSNP:rs121908955).
{ECO:0000269|PubMed:16100712,
ECO:0000269|PubMed:16996541,
ECO:0000269|PubMed:18853459,
ECO:0000269|PubMed:9731526}.
/FTId=VAR_012311.
VARIANT 2068 2068 P -> L (in MMD1; dbSNP:rs149732545).
{ECO:0000269|PubMed:15477515}.
/FTId=VAR_057881.
MUTAGEN 16 16 D->A: Fails to bind calcium.
{ECO:0000269|PubMed:24461013}.
MUTAGEN 21 21 D->A: Fails to bind calcium.
{ECO:0000269|PubMed:24461013}.
MUTAGEN 71 71 D->A: Fails to bind calcium.
{ECO:0000269|PubMed:24461013}.
MUTAGEN 79 79 R->D: Moderately increased calcium
affinity. {ECO:0000269|PubMed:24461013}.
MUTAGEN 80 80 F->A: Reduced calcium affinity.
{ECO:0000269|PubMed:24461013}.
STRAND 1 11 {ECO:0000244|PDB:4IQH}.
STRAND 22 28 {ECO:0000244|PDB:4IQH}.
STRAND 31 34 {ECO:0000244|PDB:4IQH}.
STRAND 45 53 {ECO:0000244|PDB:4IQH}.
STRAND 64 71 {ECO:0000244|PDB:4IQH}.
STRAND 74 76 {ECO:0000244|PDB:4IQH}.
STRAND 79 87 {ECO:0000244|PDB:4IQH}.
HELIX 89 92 {ECO:0000244|PDB:4IQH}.
STRAND 98 106 {ECO:0000244|PDB:4IQH}.
STRAND 112 123 {ECO:0000244|PDB:4IQH}.
STRAND 946 958 {ECO:0000244|PDB:4CAH}.
STRAND 966 973 {ECO:0000244|PDB:4CAH}.
HELIX 983 985 {ECO:0000244|PDB:4CAH}.
STRAND 996 998 {ECO:0000244|PDB:4CAH}.
STRAND 1000 1002 {ECO:0000244|PDB:4CAI}.
STRAND 1011 1015 {ECO:0000244|PDB:4CAH}.
STRAND 1021 1023 {ECO:0000244|PDB:4CAH}.
STRAND 1028 1030 {ECO:0000244|PDB:4CAH}.
STRAND 1037 1049 {ECO:0000244|PDB:4CAH}.
SEQUENCE 2080 AA; 237295 MW; 376E25A5AB9BE398 CRC64;
MLRVFILYAE NVHTPDTDIS DAYCSAVFAG VKKRTKVIKN SVNPVWNEGF EWDLKGIPLD
QGSELHVVVK DHETMGRNRF LGEAKVPLRE VLATPSLSAS FNAPLLDTKK QPTGASLVLQ
VSYTPLPGAV PLFPPPTPLE PSPTLPDLDV VADTGGEEDT EDQGLTGDEA EPFLDQSGGP
GAPTTPRKLP SRPPPHYPGI KRKRSAPTSR KLLSDKPQDF QIRVQVIEGR QLPGVNIKPV
VKVTAAGQTK RTRIHKGNSP LFNETLFFNL FDSPGELFDE PIFITVVDSR SLRTDALLGE
FRMDVGTIYR EPRHAYLRKW LLLSDPDDFS AGARGYLKTS LCVLGPGDEA PLERKDPSED
KEDIESNLLR PTGVALRGAH FCLKVFRAED LPQMDDAVMD NVKQIFGFES NKKNLVDPFV
EVSFAGKMLC SKILEKTANP QWNQNITLPA MFPSMCEKMR IRIIDWDRLT HNDIVATTYL
SMSKISAPGG EIEEEPAGAV KPSKASDLDD YLGFLPTFGP CYINLYGSPR EFTGFPDPYT
ELNTGKGEGV AYRGRLLLSL ETKLVEHSEQ KVEDLPADDI LRVEKYLRRR KYSLFAAFYS
ATMLQDVDDA IQFEVSIGNY GNKFDMTCLP LASTTQYSRA VFDGCHYYYL PWGNVKPVVV
LSSYWEDISH RIETQNQLLG IADRLEAGLE QVHLALKAQC STEDVDSLVA QLTDELIAGC
SQPLGDIHET PSATHLDQYL YQLRTHHLSQ ITEAALALKL GHSELPAALE QAEDWLLRLR
ALAEEPQNSL PDIVIWMLQG DKRVAYQRVP AHQVLFSRRG ANYCGKNCGK LQTIFLKYPM
EKVPGARMPV QIRVKLWFGL SVDEKEFNQF AEGKLSVFAE TYENETKLAL VGNWGTTGLT
YPKFSDVTGK IKLPKDSFRP SAGWTWAGDW FVCPEKTLLH DMDAGHLSFV EEVFENQTRL
PGGQWIYMSD NYTDVNGEKV LPKDDIECPL GWKWEDEEWS TDLNRAVDEQ GWEYSITIPP
ERKPKHWVPA EKMYYTHRRR RWVRLRRRDL SQMEALKRHR QAEAEGEGWE YASLFGWKFH
LEYRKTDAFR RRRWRRRMEP LEKTGPAAVF ALEGALGGVM DDKSEDSMSV STLSFGVNRP
TISCIFDYGN RYHLRCYMYQ ARDLAAMDKD SFSDPYAIVS FLHQSQKTVV VKNTLNPTWD
QTLIFYEIEI FGEPATVAEQ PPSIVVELYD HDTYGADEFM GRCICQPSLE RMPRLAWFPL
TRGSQPSGEL LASFELIQRE KPAIHHIPGF EVQETSRILD ESEDTDLPYP PPQREANIYM
VPQNIKPALQ RTAIEILAWG LRNMKSYQLA NISSPSLVVE CGGQTVQSCV IRNLRKNPNF
DICTLFMEVM LPREELYCPP ITVKVIDNRQ FGRRPVVGQC TIRSLESFLC DPYSAESPSP
QGGPDDVSLL SPGEDVLIDI DDKEPLIPIQ EEEFIDWWSK FFASIGEREK CGSYLEKDFD
TLKVYDTQLE NVEAFEGLSD FCNTFKLYRG KTQEETEDPS VIGEFKGLFK IYPLPEDPAI
PMPPRQFHQL AAQGPQECLV RIYIVRAFGL QPKDPNGKCD PYIKISIGKK SVSDQDNYIP
CTLEPVFGKM FELTCTLPLE KDLKITLYDY DLLSKDEKIG ETVVDLENRL LSKFGARCGL
PQTYCVSGPN QWRDQLRPSQ LLHLFCQQHR VKAPVYRTDR VMFQDKEYSI EEIEAGRIPN
PHLGPVEERL ALHVLQQQGL VPEHVESRPL YSPLQPDIEQ GKLQMWVDLF PKALGRPGPP
FNITPRRARR FFLRCIIWNT RDVILDDLSL TGEKMSDIYV KGWMIGFEEH KQKTDVHYRS
LGGEGNFNWR FIFPFDYLPA EQVCTIAKKD AFWRLDKTES KIPARVVFQI WDNDKFSFDD
FLGSLQLDLN RMPKPAKTAK KCSLDQLDDA FHPEWFVSLF EQKTVKGWWP CVAEEGEKKI
LAGKLEMTLE IVAESEHEER PAGQGRDEPN MNPKLEDPRR PDTSFLWFTS PYKTMKFILW
RRFRWAIILF IILFILLLFL AIFIYAFPNY AAMKLVKPFS


Related products :

Catalog number Product name Quantity
18-272-196251 Dysferlin - Rabbit polyclonal to Dysferlin; Dystrophy-associated fer-1-like protein; Fer-1-like protein 1 Polyclonal 0.5 ml
EIAAB12220 Bos taurus,Bovine,DYSF,Dysferlin,Dystrophy-associated fer-1-like protein,FER1L1,Fer-1-like protein 1
EIAAB12221 Dysf,Dysferlin,Dystrophy-associated fer-1-like protein,Fer1l1,Fer-1-like protein 1,Mouse,Mus musculus
EIAAB12222 DYSF,Dysferlin,Dystrophy-associated fer-1-like protein,FER1L1,Fer-1-like protein 1,Homo sapiens,Human
18-272-196252 Dysferlin prediluted - Rabbit polyclonal to Dysferlin prediluted; Dystrophy-associated fer-1-like protein; Fer-1-like protein 1 Polyclonal 7 ml
DYT10 DYSF Gene dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive)
GWB-AD20F8 Dysferlin Limb Girdle Muscular Dystrophy 2b (AUTOSOMAL RECESSIVE) (DYSF) Rabbit anti-Human Polyclonal (C-Terminus) Antibody
GWB-620B4F Dysferlin Limb Girdle Muscular Dystrophy 2b (AUTOSOMAL RECESSIVE) (DYSF) Rabbit anti-Human Polyclonal (aa2004-2021) Antibody
CSB-EL007314BO Bovine dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) (DYSF) ELISA kit, Species Bovine, Sample Type serum, plasma 96T
CSB-EL007314MO Mouse dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) (DYSF) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL007314HU Human dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) (DYSF) ELISA kit, Species Human, Sample Type serum, plasma 96T
EIAAB25361 CDC42-binding protein kinase beta,CDC42BPB,CDC42BP-beta,DMPK-like beta,Homo sapiens,Human,KIAA1124,MRCK beta,Myotonic dystrophy kinase-related CDC42-binding kinase beta,Myotonic dystrophy protein kina
EIAAB25364 CDC42-binding protein kinase gamma,CDC42BPG,DMPK2,DMPK-like gamma,Homo sapiens,Human,MRCK gamma,MRCKG,Myotonic dystrophy kinase-related CDC42-binding kinase gamma,Myotonic dystrophy protein kinase-lik
EIAAB25359 CDC42-binding protein kinase alpha,CDC42BPA,DMPK-like alpha,Homo sapiens,Human,KIAA0451,MRCK alpha,Myotonic dystrophy kinase-related CDC42-binding kinase alpha,Myotonic dystrophy protein kinase-like a
EIAAB25365 CDC42-binding protein kinase gamma,Cdc42bpg,DMPK-like gamma,Mouse,MRCK gamma,Mus musculus,Myotonic dystrophy kinase-related CDC42-binding kinase gamma,Myotonic dystrophy protein kinase-like alpha,Myot
EIAAB25358 CDC42-binding protein kinase alpha,Cdc42bpa,MRCK alpha,Myotonic dystrophy kinase-related CDC42-binding kinase alpha,Myotonic dystrophy protein kinase-like alpha,Pk428,Rat,Rattus norvegicus,Serine_thre
EIAAB25362 CDC42-binding protein kinase beta,Cdc42bpb,DMPK-like beta,Kiaa1124,Mouse,MRCK beta,Mus musculus,Myotonic dystrophy kinase-related CDC42-binding kinase beta,Myotonic dystrophy protein kinase-like beta,
EIAAB25363 CDC42-binding protein kinase beta,Cdc42bpb,DMPK-like beta,MRCK beta,Myotonic dystrophy kinase-related CDC42-binding kinase beta,Myotonic dystrophy protein kinase-like beta,Rat,Rattus norvegicus,Serine
18-003-42261 Autoimmune regulator - Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein; APECED protein Polyclonal 0.05 mg Aff Pur
18-003-42260 Autoimmune regulator - Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein; APECED protein Polyclonal 0.05 mg Aff Pur
18-003-42260 Autoimmune regulator - Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein; APECED protein Polyclonal 0.1 mg Protein A
DYT13 DYSFIP1 Gene dysferlin interacting protein 1
E13844h Human Dysferlin Interacting Protein 1 ELISA Kit 96T
EIAAB12224 Dysferlin-interacting protein 1,Dysfip1,Mouse,Mus musculus
CSB-EL007315MO Mouse Dysferlin-interacting protein 1(DYSFIP1) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur