Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Elongator complex protein 4 (hELP4) (PAX6 neighbor gene protein)

 ELP4_HUMAN              Reviewed;         424 AA.
Q96EB1; B4E3W0; E7EPZ6; Q9H4E8; Q9NX11;
17-APR-2007, integrated into UniProtKB/Swiss-Prot.
17-APR-2007, sequence version 2.
28-MAR-2018, entry version 126.
RecName: Full=Elongator complex protein 4;
Short=hELP4;
AltName: Full=PAX6 neighbor gene protein;
Name=ELP4; Synonyms=C11orf19, PAXNEB;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=11230166; DOI=10.1101/gr.GR1547R;
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S.,
Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H.,
Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N.,
Mewes H.-W., Ottenwaelder B., Obermaier B., Tampe J., Heubner D.,
Wambutt R., Korn B., Klein M., Poustka A.;
"Towards a catalog of human genes and proteins: sequencing and
analysis of 500 novel complete protein coding human cDNAs.";
Genome Res. 11:422-435(2001).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16554811; DOI=10.1038/nature04632;
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K.,
Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F.,
Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E.,
FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S.,
Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W.,
Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S.,
Sakaki Y.;
"Human chromosome 11 DNA sequence and analysis including novel gene
identification.";
Nature 440:497-500(2006).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-74, SUBCELLULAR LOCATION, AND
TISSUE SPECIFICITY.
PubMed=11889558; DOI=10.1007/s00335-001-3058-y;
Kleinjan D.A., Seawright A., Elgar G., van Heyningen V.;
"Characterization of a novel gene adjacent to PAX6, revealing synteny
conservation with functional significance.";
Mamm. Genome 13:102-107(2002).
[6]
IDENTIFICATION IN THE RNA POLYMERASE II ELONGATOR COMPLEX, FUNCTION OF
THE RNA POLYMERASE II ELONGATOR COMPLEX, AND IDENTIFICATION BY MASS
SPECTROMETRY.
PubMed=11714725; DOI=10.1074/jbc.M110445200;
Hawkes N.A., Otero G., Winkler G.S., Marshall N., Dahmus M.E.,
Krappmann D., Scheidereit C., Thomas C.L., Schiavo G.,
Erdjument-Bromage H., Tempst P., Svejstrup J.Q.;
"Purification and characterization of the human elongator complex.";
J. Biol. Chem. 277:3047-3052(2002).
[7]
FUNCTION OF THE RNA POLYMERASE II ELONGATOR COMPLEX.
PubMed=11818576; DOI=10.1073/pnas.251672198;
Kim J.H., Lane W.S., Reinberg D.;
"Human Elongator facilitates RNA polymerase II transcription through
chromatin.";
Proc. Natl. Acad. Sci. U.S.A. 99:1241-1246(2002).
[8]
FUNCTION OF THE RNA POLYMERASE II ELONGATOR COMPLEX.
PubMed=16713582; DOI=10.1016/j.molcel.2006.04.017;
Close P., Hawkes N., Cornez I., Creppe C., Lambert C.A., Rogister B.,
Siebenlist U., Merville M.P., Slaugenhaupt S.A., Bours V.,
Svejstrup J.Q., Chariot A.;
"Transcription impairment and cell migration defects in elongator-
depleted cells: implication for familial dysautonomia.";
Mol. Cell 22:521-531(2006).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[10]
IDENTIFICATION IN THE RNA POLYMERASE II ELONGATOR COMPLEX, AND
SUBCELLULAR LOCATION.
PubMed=22854966; DOI=10.1074/jbc.M112.402727;
Close P., Gillard M., Ladang A., Jiang Z., Papuga J., Hawkes N.,
Nguyen L., Chapelle J.P., Bouillenne F., Svejstrup J., Fillet M.,
Chariot A.;
"DERP6 (ELP5) and C3ORF75 (ELP6) regulate tumorigenicity and migration
of melanoma cells as subunits of Elongator.";
J. Biol. Chem. 287:32535-32545(2012).
[11]
INVOLVEMENT IN AN2.
PubMed=24290376; DOI=10.1016/j.ajhg.2013.10.028;
Bhatia S., Bengani H., Fish M., Brown A., Divizia M.T., de Marco R.,
Damante G., Grainger R., van Heyningen V., Kleinjan D.A.;
"Disruption of autoregulatory feedback by a mutation in a remote,
ultraconserved PAX6 enhancer causes aniridia.";
Am. J. Hum. Genet. 93:1126-1134(2013).
-!- FUNCTION: Acts as subunit of the RNA polymerase II elongator
complex, which is a histone acetyltransferase component of the RNA
polymerase II (Pol II) holoenzyme and is involved in
transcriptional elongation. Elongator may play a role in chromatin
remodeling and is involved in acetylation of histones H3 and
probably H4. {ECO:0000269|PubMed:11714725,
ECO:0000269|PubMed:11818576, ECO:0000269|PubMed:16713582}.
-!- SUBUNIT: Component of the RNA polymerase II elongator complex
(Elongator), which consists of ELP1, STIP1/ELP2, ELP3, ELP4, ELP5
and ELP6. Elongator associates with the C-terminal domain (CTD) of
Pol II largest subunit. {ECO:0000269|PubMed:11714725,
ECO:0000269|PubMed:22854966}.
-!- INTERACTION:
Q8TE02:ELP5; NbExp=4; IntAct=EBI-3951755, EBI-946189;
-!- SUBCELLULAR LOCATION: Cytoplasm. Nucleus.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q96EB1-1; Sequence=Displayed;
Name=2;
IsoId=Q96EB1-2; Sequence=VSP_024409;
Name=3;
IsoId=Q96EB1-3; Sequence=VSP_054128, VSP_054129;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Widely expressed.
{ECO:0000269|PubMed:11889558}.
-!- DISEASE: Aniridia 2 (AN2) [MIM:617141]: A form of aniridia, a
congenital, bilateral, panocular disorder characterized by
complete absence of the iris or extreme iris hypoplasia. Aniridia
is not just an isolated defect in iris development but it is
associated with macular and optic nerve hypoplasia, cataract,
corneal changes, nystagmus. Visual acuity is generally low but is
unrelated to the degree of iris hypoplasia. Glaucoma is a
secondary problem causing additional visual loss over time.
{ECO:0000269|PubMed:24290376}. Note=The disease is caused by
mutations affecting the gene represented in this entry. A disease-
causing mutation is located in intron 9 of ELP4. The mutation does
not alter normal ELP4 expression and function, but disrupts a
long-range cis-regulatory element of PAX6 expression, known as
SIMO. SIMO is contained within ELP4 intron 9 and located 150 kb
downstream of PAX6. {ECO:0000269|PubMed:24290376}.
-!- SIMILARITY: Belongs to the ELP4 family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AL136677; CAB66612.1; -; mRNA.
EMBL; AK000505; BAA91212.1; -; mRNA.
EMBL; AK304885; BAG65622.1; -; mRNA.
EMBL; AC108456; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC131571; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; Z83001; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; Z83306; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; Z83307; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC012514; AAH12514.1; -; mRNA.
EMBL; AJ276005; CAC08200.1; -; Genomic_DNA.
CCDS; CCDS73271.1; -. [Q96EB1-3]
CCDS; CCDS73272.1; -. [Q96EB1-2]
CCDS; CCDS7875.2; -. [Q96EB1-1]
RefSeq; NP_001275654.1; NM_001288725.1. [Q96EB1-3]
RefSeq; NP_001275655.1; NM_001288726.1.
RefSeq; NP_061913.3; NM_019040.4. [Q96EB1-1]
UniGene; Hs.175534; -.
UniGene; Hs.614864; -.
ProteinModelPortal; Q96EB1; -.
BioGrid; 117764; 17.
CORUM; Q96EB1; -.
IntAct; Q96EB1; 7.
MINT; Q96EB1; -.
STRING; 9606.ENSP00000298937; -.
iPTMnet; Q96EB1; -.
PhosphoSitePlus; Q96EB1; -.
BioMuta; ELP4; -.
DMDM; 145558903; -.
EPD; Q96EB1; -.
MaxQB; Q96EB1; -.
PaxDb; Q96EB1; -.
PeptideAtlas; Q96EB1; -.
PRIDE; Q96EB1; -.
DNASU; 26610; -.
Ensembl; ENST00000379163; ENSP00000368461; ENSG00000109911. [Q96EB1-3]
Ensembl; ENST00000640961; ENSP00000492152; ENSG00000109911. [Q96EB1-1]
GeneID; 26610; -.
KEGG; hsa:26610; -.
UCSC; uc001mtb.5; human. [Q96EB1-1]
CTD; 26610; -.
DisGeNET; 26610; -.
EuPathDB; HostDB:ENSG00000109911.17; -.
GeneCards; ELP4; -.
H-InvDB; HIX0009527; -.
HGNC; HGNC:1171; ELP4.
HPA; HPA038572; -.
HPA; HPA038573; -.
MalaCards; ELP4; -.
MIM; 606985; gene.
MIM; 617141; phenotype.
neXtProt; NX_Q96EB1; -.
OpenTargets; ENSG00000109911; -.
PharmGKB; PA27764; -.
eggNOG; KOG3949; Eukaryota.
eggNOG; ENOG410XP5H; LUCA.
GeneTree; ENSGT00390000001443; -.
HOGENOM; HOG000007516; -.
HOVERGEN; HBG104285; -.
InParanoid; Q96EB1; -.
KO; K11375; -.
PhylomeDB; Q96EB1; -.
TreeFam; TF320797; -.
Reactome; R-HSA-3214847; HATs acetylate histones.
ChiTaRS; ELP4; human.
GeneWiki; ELP4; -.
GenomeRNAi; 26610; -.
PRO; PR:Q96EB1; -.
Proteomes; UP000005640; Chromosome 11.
Bgee; ENSG00000109911; -.
CleanEx; HS_ELP4; -.
ExpressionAtlas; Q96EB1; baseline and differential.
Genevisible; Q96EB1; HS.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0033588; C:Elongator holoenzyme complex; IDA:UniProtKB.
GO; GO:0000123; C:histone acetyltransferase complex; IDA:BHF-UCL.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0008023; C:transcription elongation factor complex; IDA:UniProtKB.
GO; GO:0008607; F:phosphorylase kinase regulator activity; IDA:UniProtKB.
GO; GO:0043966; P:histone H3 acetylation; IDA:BHF-UCL.
GO; GO:0043967; P:histone H4 acetylation; IDA:BHF-UCL.
GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IDA:UniProtKB.
GO; GO:0006368; P:transcription elongation from RNA polymerase II promoter; TAS:BHF-UCL.
GO; GO:0002098; P:tRNA wobble uridine modification; IEA:InterPro.
InterPro; IPR008728; Elongator_complex_protein_4.
PANTHER; PTHR12896; PTHR12896; 1.
Pfam; PF05625; PAXNEB; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm; Nucleus;
Polymorphism; Reference proteome; Transcription;
Transcription regulation.
CHAIN 1 424 Elongator complex protein 4.
/FTId=PRO_0000284004.
VAR_SEQ 171 171 E -> EQ (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_054128.
VAR_SEQ 382 424 RLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKKHL
DF -> AGVQWHDLGSRRPRLLGSGGSPASASLVAGITGAH
HHAQLIFVFLVEMGFHHVGQAGLELLTSGDSSASASQSAGI
AGMSYRARPRALYFKENKSKVGARQLLETREEHLSSRLLIL
TQAERLCMGRRFFTAFHIFNELPCKGDCICLQTCQTQ (in
isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_024409.
VAR_SEQ 382 424 RLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKKHL
DF -> WVQDNYLRQERNIYPPGFSYLLKQKDSAWGEGSLQ
HSTFLMSFLAKATAFASRLVRHSEPLKQNGSGRIRQAAGPR
LWHDGRRQEAPGLLGIPP (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_054129.
VARIANT 300 300 I -> L (in dbSNP:rs34804357).
/FTId=VAR_053881.
SEQUENCE 424 AA; 46588 MW; A044C964F7C91E73 CRC64;
MAAVATCGSV AASTGSAVAT ASKSNVTSFQ RRGPRASVTN DSGPRLVSIA GTRPSVRNGQ
LLVSTGLPAL DQLLGGGLAV GTVLLIEEDK YNIYSPLLFK YFLAEGIVNG HTLLVASAKE
DPANILQELP APLLDDKCKK EFDEDVYNHK TPESNIKMKI AWRYQLLPKM EIGPVSSSRF
GHYYDASKRM PQELIEASNW HGFFLPEKIS STLKVEPCSL TPGYTKLLQF IQNIIYEEGF
DGSNPQKKQR NILRIGIQNL GSPLWGDDIC CAENGGNSHS LTKFLYVLRG LLRTSLSACI
ITMPTHLIQN KAIIARVTTL SDVVVGLESF IGSERETNPL YKDYHGLIHI RQIPRLNNLI
CDESDVKDLA FKLKRKLFTI ERLHLPPDLS DTVSRSSKMD LAESAKRLGP GCGMMAGGKK
HLDF


Related products :

Catalog number Product name Quantity
EIAAB12866 C11orf19,Elongator complex protein 4,ELP4,hELP4,Homo sapiens,Human,PAX6 neighbor gene protein,PAXNEB
EIAAB12864 Elongator complex protein 4,Elp4,Mouse,Mus musculus,PAX6 neighbor gene protein,Paxneb
EIAAB12853 Elongator complex protein 1,ELP1,ELP1,Homo sapiens,Human,IKAP,IkappaB kinase complex-associated protein,IKBKAP,IKK complex-associated protein,p150
EIAAB12854 Elongator complex protein 1,ELP1,ELP1,IKAP,IkappaB kinase complex-associated protein,IKBKAP,IKK complex-associated protein,Oryctolagus cuniculus,Rabbit
EIAAB12855 Elongator complex protein 1,ELP1,Elp1,Ikap,IkappaB kinase complex-associated protein,Ikbkap,IKK complex-associated protein,Mouse,Mus musculus
EIAAB12856 Elongator complex protein 1,ELP1,Elp1,Ikap,IkappaB kinase complex-associated protein,Ikbkap,IKK complex-associated protein,Rat,Rattus norvegicus
ELP3_MOUSE ELISA Kit FOR Elongator complex protein 3; organism: Mouse; gene name: Elp3 96T
ELP4_MOUSE ELISA Kit FOR Elongator complex protein 4; organism: Mouse; gene name: Elp4 96T
ELP2_MOUSE ELISA Kit FOR Elongator complex protein 2; organism: Mouse; gene name: Elp2 96T
ELP1_MOUSE ELISA Kit FOR Elongator complex protein 1; organism: Mouse; gene name: Ikbkap 96T
IKBZ_HUMAN Human ELISA Kit FOR Elongator complex protein 2 96T
CSB-EL007626RA Rat Elongator complex protein 2(ELP2) ELISA kit 96T
ELP6_HUMAN Human ELISA Kit FOR Elongator complex protein 6 96T
ELP3_MOUSE Mouse ELISA Kit FOR Elongator complex protein 3 96T
E15020h Bovine ELISA Kit FOR Elongator complex protein 4 96T
ELP5_HUMAN Human ELISA Kit FOR Elongator complex protein 5 96T
E0890r Human ELISA Kit FOR Elongator complex protein 3 96T
E0214m Human ELISA Kit FOR Elongator complex protein 2 96T
CSB-EL011571RA Rat Elongator complex protein 1(IKBKAP) ELISA kit 96T
ACO15_HUMAN Human ELISA Kit FOR Elongator complex protein 2 96T
CSB-EL007627CH Chicken Elongator complex protein 3(ELP3) ELISA kit 96T
EIAAB12861 Bos taurus,Bovine,Elongator complex protein 3,ELP3
EIAAB12863 Elongator complex protein 3,Elp3,Mouse,Mus musculus
EIAAB12865 Bos taurus,Bovine,Elongator complex protein 4,ELP4
CSB-EL007628BO Bovine Elongator complex protein 4(ELP4) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur