Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Endothelin-3 (ET-3) (Preproendothelin-3) (PPET3)

 EDN3_HUMAN              Reviewed;         238 AA.
P14138; E1P5I5; Q03229; Q7Z6D2; Q9UGT7;
01-JAN-1990, integrated into UniProtKB/Swiss-Prot.
01-JAN-1990, sequence version 1.
22-NOV-2017, entry version 183.
RecName: Full=Endothelin-3;
Short=ET-3;
AltName: Full=Preproendothelin-3;
Short=PPET3;
Flags: Precursor;
Name=EDN3;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA].
PubMed=2509452;
Bloch K.D., Eddy R.L., Shows T.B., Quertermous T.;
"cDNA cloning and chromosomal assignment of the gene encoding
endothelin 3.";
J. Biol. Chem. 264:18156-18161(1989).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
TISSUE=Placenta;
PubMed=2178974; DOI=10.1016/0014-5793(90)80583-5;
Onda H., Ohkubo S., Ogi K., Kosaka T., Kimura C., Matsumoto H.,
Suzuki N., Fujino M.;
"One of the endothelin gene family, endothelin 3 gene, is expressed in
the placenta.";
FEBS Lett. 261:327-330(1990).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG).
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANT THR-17.
NIEHS SNPs program;
Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=11780052; DOI=10.1038/414865a;
Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R.,
Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L.,
Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M.,
Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Brown A.J.,
Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P.,
Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M.,
Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R.,
Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M.,
Ellington A.G., Frankland J.A., Fraser A., French L., Garner P.,
Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E.,
Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J.,
Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D.,
Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S.,
Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D.,
Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A.,
Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T.,
Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I.,
Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H.,
Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S.,
Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E.,
Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A.,
Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M.,
Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A.,
Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S.,
Rogers J.;
"The DNA sequence and comparative analysis of human chromosome 20.";
Nature 414:865-871(2001).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND 3).
TISSUE=Lung, and Muscle;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
PARTIAL PROTEIN SEQUENCE, CLEAVAGE BY KELL, AND IDENTIFICATION BY MASS
SPECTROMETRY.
PubMed=10438732;
Lee S., Lin M., Mele A., Cao Y., Farmar J., Russo D., Redman C.;
"Proteolytic processing of big endothelin-3 by the kell blood group
protein.";
Blood 94:1440-1450(1999).
[9]
TISSUE SPECIFICITY.
PubMed=9284755; DOI=10.1210/jcem.82.9.4209;
Bourgeois C., Robert B., Rebourcet R., Mondon F., Mignot T.-M.,
Duc-Goiran P., Ferre F.;
"Endothelin-1 and ETA receptor expression in vascular smooth muscle
cells from human placenta: a new ETA receptor messenger ribonucleic
acid is generated by alternative splicing of exon 3.";
J. Clin. Endocrinol. Metab. 82:3116-3123(1997).
[10]
STRUCTURE BY NMR OF ET-3.
PubMed=1610811; DOI=10.1021/bi00139a030;
Mills R.G., O'Donoghue S.I., Smith R., King G.F.;
"Solution structure of endothelin-3 determined using NMR
spectroscopy.";
Biochemistry 31:5640-5645(1992).
[11]
REVIEW ON VARIANTS.
PubMed=9359036;
Hofstra R.M.W., Osinga J., Buys C.H.C.M.;
"Mutations in Hirschsprung disease: when does a mutation contribute to
the phenotype.";
Eur. J. Hum. Genet. 5:180-185(1997).
[12]
VARIANT WS4B PHE-159.
PubMed=8630503; DOI=10.1038/ng0496-445;
Hofstra R.M.W., Tan-Sindhunata G., Wu Y., Kamsteeg E.-J., Stulp R.P.,
van Ravenswaaij-Arts C., Majoor-Krakauer D., Angrist M.,
Chakravarti A., Meijers C., Buys C.H.C.M.;
"A homozygous mutation in the endothelin-3 gene associated with a
combined Waardenburg type 2 and Hirschsprung phenotype (Shah-
Waardenburg syndrome).";
Nat. Genet. 12:445-447(1996).
[13]
INVOLVEMENT IN CCHS.
PubMed=8696331; DOI=10.1038/ng0896-395;
Bolk S., Angrist M., Xie J., Yanagisawa M., Silvestri J.M.,
Weese-Mayer D.E., Chakravarti A.;
"Endothelin-3 frameshift mutation in congenital central
hypoventilation syndrome.";
Nat. Genet. 13:395-396(1996).
[14]
VARIANT HSCR4 THR-224, AND VARIANT THR-17.
PubMed=9359047;
Bidaud C., Salomon R., Van Camp G., Pelet A., Attie T., Eng C.,
Bonduelle M., Amiel J., Nihoul-Fekete C., Willems P.J., Munnich A.,
Lyonnet S.;
"Endothelin-3 gene mutations in isolated and syndromic Hirschsprung
disease.";
Eur. J. Hum. Genet. 5:247-251(1997).
[15]
INVOLVEMENT IN WS4B.
PubMed=11303518; DOI=10.1136/jmg.38.3.205;
Pingault V., Bondurand N., Lemort N., Sancandi M., Ceccherini I.,
Hugot J.P., Jouk P.S., Goossens M.;
"A heterozygous endothelin 3 mutation in Waardenburg-Hirschsprung
disease: is there a dosage effect of EDN3/EDNRB gene mutations on
neurocristopathy phenotypes?";
J. Med. Genet. 38:205-209(2001).
[16]
VARIANT WS4B CYS-127.
PubMed=12189494; DOI=10.1007/s00439-002-0765-8;
Pingault V., Girard M., Bondurand N., Dorkins H., Van Maldergem L.,
Mowat D., Shimotake T., Verma I., Baumann C., Goossens M.;
"SOX10 mutations in chronic intestinal pseudo-obstruction suggest a
complex physiopathological mechanism.";
Hum. Genet. 111:198-206(2002).
[17]
VARIANT THR-17.
PubMed=27535533; DOI=10.1038/nature19057;
Exome Aggregation Consortium;
Lek M., Karczewski K.J., Minikel E.V., Samocha K.E., Banks E.,
Fennell T., O'Donnell-Luria A.H., Ware J.S., Hill A.J., Cummings B.B.,
Tukiainen T., Birnbaum D.P., Kosmicki J.A., Duncan L.E., Estrada K.,
Zhao F., Zou J., Pierce-Hoffman E., Berghout J., Cooper D.N.,
Deflaux N., DePristo M., Do R., Flannick J., Fromer M., Gauthier L.,
Goldstein J., Gupta N., Howrigan D., Kiezun A., Kurki M.I.,
Moonshine A.L., Natarajan P., Orozco L., Peloso G.M., Poplin R.,
Rivas M.A., Ruano-Rubio V., Rose S.A., Ruderfer D.M., Shakir K.,
Stenson P.D., Stevens C., Thomas B.P., Tiao G., Tusie-Luna M.T.,
Weisburd B., Won H.H., Yu D., Altshuler D.M., Ardissino D.,
Boehnke M., Danesh J., Donnelly S., Elosua R., Florez J.C.,
Gabriel S.B., Getz G., Glatt S.J., Hultman C.M., Kathiresan S.,
Laakso M., McCarroll S., McCarthy M.I., McGovern D., McPherson R.,
Neale B.M., Palotie A., Purcell S.M., Saleheen D., Scharf J.M.,
Sklar P., Sullivan P.F., Tuomilehto J., Tsuang M.T., Watkins H.C.,
Wilson J.G., Daly M.J., MacArthur D.G.;
"Analysis of protein-coding genetic variation in 60,706 humans.";
Nature 536:285-291(2016).
-!- FUNCTION: Endothelins are endothelium-derived vasoconstrictor
peptides.
-!- SUBCELLULAR LOCATION: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=Long;
IsoId=P14138-1; Sequence=Displayed;
Name=Short;
IsoId=P14138-2; Sequence=VSP_001445;
Name=3;
IsoId=P14138-3; Sequence=VSP_043139;
-!- TISSUE SPECIFICITY: Expressed in trophoblasts and placental stem
villi vessels, but not in cultured placental smooth muscle cells.
{ECO:0000269|PubMed:9284755}.
-!- DISEASE: Hirschsprung disease 4 (HSCR4) [MIM:613712]: A disorder
of neural crest development characterized by absence of enteric
ganglia along a variable length of the intestine. It is the most
common cause of congenital intestinal obstruction. Early symptoms
range from complete acute neonatal obstruction, characterized by
vomiting, abdominal distention and failure to pass stool, to
chronic constipation in the older child.
{ECO:0000269|PubMed:9359047}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Congenital central hypoventilation syndrome (CCHS)
[MIM:209880]: Rare disorder characterized by abnormal control of
respiration in the absence of neuromuscular or lung disease, or an
identifiable brain stem lesion. A deficiency in autonomic control
of respiration results in inadequate or negligible ventilatory and
arousal responses to hypercapnia and hypoxemia.
{ECO:0000269|PubMed:8696331}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Waardenburg syndrome 4B (WS4B) [MIM:613265]: A disorder
characterized by the association of Waardenburg features
(depigmentation and deafness) with the absence of enteric ganglia
in the distal part of the intestine (Hirschsprung disease).
{ECO:0000269|PubMed:11303518, ECO:0000269|PubMed:12189494,
ECO:0000269|PubMed:8630503}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the endothelin/sarafotoxin family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAR16083.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=NIEHS-SNPs;
URL="http://egp.gs.washington.edu/data/edn3/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; J05081; AAA52405.1; -; mRNA.
EMBL; X52001; CAA36252.1; -; mRNA.
EMBL; BT007085; AAP35748.1; -; mRNA.
EMBL; AY444503; AAR16083.1; ALT_SEQ; Genomic_DNA.
EMBL; AL035250; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471077; EAW75434.1; -; Genomic_DNA.
EMBL; CH471077; EAW75435.1; -; Genomic_DNA.
EMBL; CH471077; EAW75437.1; -; Genomic_DNA.
EMBL; BC008876; AAH08876.1; -; mRNA.
EMBL; BC053866; AAH53866.1; -; mRNA.
CCDS; CCDS13477.1; -. [P14138-1]
CCDS; CCDS13478.1; -. [P14138-2]
CCDS; CCDS13479.1; -. [P14138-3]
PIR; A34378; A34378.
RefSeq; NP_001289384.1; NM_001302455.1.
RefSeq; NP_001289385.1; NM_001302456.1.
RefSeq; NP_996915.1; NM_207032.2. [P14138-3]
RefSeq; NP_996916.1; NM_207033.2. [P14138-2]
RefSeq; NP_996917.1; NM_207034.2. [P14138-1]
UniGene; Hs.1408; -.
ProteinModelPortal; P14138; -.
SMR; P14138; -.
BioGrid; 108230; 23.
STRING; 9606.ENSP00000337128; -.
iPTMnet; P14138; -.
PhosphoSitePlus; P14138; -.
BioMuta; EDN3; -.
DMDM; 119618; -.
PaxDb; P14138; -.
PeptideAtlas; P14138; -.
PRIDE; P14138; -.
DNASU; 1908; -.
Ensembl; ENST00000311585; ENSP00000311854; ENSG00000124205. [P14138-3]
Ensembl; ENST00000337938; ENSP00000337128; ENSG00000124205. [P14138-1]
Ensembl; ENST00000371028; ENSP00000360067; ENSG00000124205. [P14138-1]
Ensembl; ENST00000395654; ENSP00000379015; ENSG00000124205. [P14138-2]
GeneID; 1908; -.
KEGG; hsa:1908; -.
UCSC; uc002yap.4; human. [P14138-1]
CTD; 1908; -.
DisGeNET; 1908; -.
EuPathDB; HostDB:ENSG00000124205.15; -.
GeneCards; EDN3; -.
GeneReviews; EDN3; -.
HGNC; HGNC:3178; EDN3.
MalaCards; EDN3; -.
MIM; 131242; gene.
MIM; 209880; phenotype.
MIM; 613265; phenotype.
MIM; 613712; phenotype.
neXtProt; NX_P14138; -.
OpenTargets; ENSG00000124205; -.
Orphanet; 388; Hirschsprung disease.
Orphanet; 661; Ondine syndrome.
Orphanet; 897; Waardenburg-Shah syndrome.
PharmGKB; PA27616; -.
eggNOG; ENOG410IXXK; Eukaryota.
eggNOG; ENOG410YW48; LUCA.
GeneTree; ENSGT00530000063310; -.
HOGENOM; HOG000231110; -.
HOVERGEN; HBG051442; -.
InParanoid; P14138; -.
KO; K05227; -.
OMA; WINTPEQ; -.
OrthoDB; EOG091G0OPZ; -.
PhylomeDB; P14138; -.
TreeFam; TF333184; -.
Reactome; R-HSA-375276; Peptide ligand-binding receptors.
Reactome; R-HSA-416476; G alpha (q) signalling events.
SIGNOR; P14138; -.
GeneWiki; Endothelin_3; -.
GenomeRNAi; 1908; -.
PMAP-CutDB; P14138; -.
PRO; PR:P14138; -.
Proteomes; UP000005640; Chromosome 20.
Bgee; ENSG00000124205; -.
CleanEx; HS_EDN3; -.
ExpressionAtlas; P14138; baseline and differential.
Genevisible; P14138; HS.
GO; GO:0005576; C:extracellular region; TAS:Reactome.
GO; GO:0005615; C:extracellular space; IDA:BHF-UCL.
GO; GO:0005622; C:intracellular; IEA:GOC.
GO; GO:0031708; F:endothelin B receptor binding; IPI:BHF-UCL.
GO; GO:0005179; F:hormone activity; IDA:BHF-UCL.
GO; GO:0005102; F:receptor binding; TAS:ProtInc.
GO; GO:0008015; P:blood circulation; TAS:ProtInc.
GO; GO:0007166; P:cell surface receptor signaling pathway; IDA:BHF-UCL.
GO; GO:0007267; P:cell-cell signaling; TAS:ProtInc.
GO; GO:0006874; P:cellular calcium ion homeostasis; IEA:Ensembl.
GO; GO:0010961; P:cellular magnesium ion homeostasis; IEA:Ensembl.
GO; GO:0048016; P:inositol phosphate-mediated signaling; IDA:BHF-UCL.
GO; GO:0030318; P:melanocyte differentiation; IEA:Ensembl.
GO; GO:0007275; P:multicellular organism development; TAS:ProtInc.
GO; GO:0001755; P:neural crest cell migration; IEA:Ensembl.
GO; GO:0030182; P:neuron differentiation; IEA:Ensembl.
GO; GO:0030593; P:neutrophil chemotaxis; IDA:BHF-UCL.
GO; GO:0030072; P:peptide hormone secretion; IDA:BHF-UCL.
GO; GO:0045597; P:positive regulation of cell differentiation; IGI:MGI.
GO; GO:0008284; P:positive regulation of cell proliferation; IDA:MGI.
GO; GO:0010460; P:positive regulation of heart rate; IDA:BHF-UCL.
GO; GO:0046887; P:positive regulation of hormone secretion; IDA:BHF-UCL.
GO; GO:0002690; P:positive regulation of leukocyte chemotaxis; IDA:BHF-UCL.
GO; GO:0043406; P:positive regulation of MAP kinase activity; IDA:BHF-UCL.
GO; GO:0045840; P:positive regulation of mitotic nuclear division; IDA:BHF-UCL.
GO; GO:1901381; P:positive regulation of potassium ion transmembrane transport; IEA:Ensembl.
GO; GO:0048070; P:regulation of developmental pigmentation; IEA:Ensembl.
GO; GO:0010468; P:regulation of gene expression; IGI:MGI.
GO; GO:0003100; P:regulation of systemic arterial blood pressure by endothelin; IDA:BHF-UCL.
GO; GO:0019229; P:regulation of vasoconstriction; IEA:InterPro.
GO; GO:0007165; P:signal transduction; TAS:ProtInc.
GO; GO:0042310; P:vasoconstriction; IDA:BHF-UCL.
GO; GO:0014826; P:vein smooth muscle contraction; IDA:BHF-UCL.
InterPro; IPR020475; Bibrotoxin/Sarafotoxin-D.
InterPro; IPR019764; Endothelin_toxin_CS.
InterPro; IPR001928; Endothln-like_toxin.
Pfam; PF00322; Endothelin; 1.
PRINTS; PR00365; ENDOTHELIN.
SMART; SM00272; END; 2.
PROSITE; PS00270; ENDOTHELIN; 2.
1: Evidence at protein level;
Alternative splicing; Cleavage on pair of basic residues;
Complete proteome; Deafness; Direct protein sequencing;
Disease mutation; Disulfide bond; Hirschsprung disease; Polymorphism;
Reference proteome; Secreted; Signal; Vasoactive; Vasoconstrictor;
Waardenburg syndrome.
SIGNAL 1 16 {ECO:0000255}.
PROPEP 17 94
/FTId=PRO_0000008111.
PEPTIDE 97 117 Endothelin-3.
/FTId=PRO_0000008112.
PROPEP 118 238
/FTId=PRO_0000008113.
REGION 159 173 Endothelin-like.
SITE 117 118 Cleavage; by KEL.
DISULFID 97 111
DISULFID 99 107
VAR_SEQ 181 196 SNSRTAEKTDKEEEGK -> RQ (in isoform
Short). {ECO:0000303|PubMed:2178974}.
/FTId=VSP_001445.
VAR_SEQ 198 238 EVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
-> RGANRGLCQRRLKSRTNKASRL (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_043139.
VARIANT 17 17 A -> T (in dbSNP:rs11570255).
{ECO:0000269|PubMed:27535533,
ECO:0000269|PubMed:9359047,
ECO:0000269|Ref.4}.
/FTId=VAR_009078.
VARIANT 127 127 Y -> C (in WS4B; dbSNP:rs752400458).
{ECO:0000269|PubMed:12189494}.
/FTId=VAR_015238.
VARIANT 159 159 C -> F (in WS4B; dbSNP:rs74315384).
{ECO:0000269|PubMed:8630503}.
/FTId=VAR_002353.
VARIANT 224 224 A -> T (in HSCR4; dbSNP:rs11570351).
{ECO:0000269|PubMed:9359047}.
/FTId=VAR_009079.
SEQUENCE 238 AA; 25454 MW; 7D7E90BC7DE37273 CRC64;
MEPGLWLLFG LTVTSAAGFV PCSQSGDAGR RGVSQAPTAA RSEGDCEETV AGPGEETVAG
PGEGTVAPTA LQGPSPGSPG QEQAAEGAPE HHRSRRCTCF TYKDKECVYY CHLDIIWINT
PEQTVPYGLS NYRGSFRGKR SAGPLPGNLQ LSHRPHLRCA CVGRYDKACL HFCTQTLDVS
SNSRTAEKTD KEEEGKVEVK DQQSKQALDL HHPKLMPGSG LALAPSTCPR CLFQEGAP


Related products :

Catalog number Product name Quantity
06-271-83200 Endothelin-3 Human - ET-3; Preproendothelin-3; PPET3 0.5 mg
06-271-83200 Endothelin-3 Human - ET-3; Preproendothelin-3; PPET3 1 mg
EIAAB12440 EDN3,Endothelin-3,ET-3,Pig,PPET3,Preproendothelin-3,Sus scrofa
EIAAB12439 Edn3,Endothelin-3,ET-3,Mouse,Mus musculus,PPET3,Preproendothelin-3
EIAAB12437 Edn3,Endothelin-3,ET-3,PPET3,Preproendothelin-3,Rat,Rattus norvegicus
EIAAB12438 EDN3,Endothelin-3,ET-3,Oryctolagus cuniculus,PPET3,Preproendothelin-3,Rabbit
EIAAB12441 EDN3,Endothelin-3,ET-3,Homo sapiens,Human,PPET3,Preproendothelin-3
EIAAB12436 Canis familiaris,Canis lupus familiaris,Dog,EDN3,Endothelin-3,ET-3,PPET3,Preproendothelin-3
20-272-191636 Endothelin 1 - Mouse monoclonal [1.B.759] to Endothelin 1; Preproendothelin-1; PPET1 Monoclonal 0.05 mg
06-271-83199 Endothelin-2 Human - ET-2; Preproendothelin-2; PPET2 0.5 mg
06-271-83199 Endothelin-2 Human - ET-2; Preproendothelin-2; PPET2 1 mg
06-271-83118 Big Endothelin-1 (1-38) Human - Preproendothelin-1; PPET1 0.5 mg
06-271-83118 Big Endothelin-1 (1-38) Human - Preproendothelin-1; PPET1 1 mg
10-783-79527 SYNTHETIC HUMAN ENDOTHELIN 2 - ET-2; Preproendothelin-2; PPET2 0.1 mg
06-271-83198 Endothelin 1 Human Porcine - Preproendothelin-1; PPET1 0.25 mg
06-271-83198 Endothelin 1 Human Porcine - Preproendothelin-1; PPET1 1 mg
EIAAB12431 Bos taurus,Bovine,EDN2,Endothelin-2,ET-2,PPET2,Preproendothelin-2
E0482p ELISA kit EDN1,Endothelin-1,ET-1,Pig,PPET1,Preproendothelin-1,Sus scrofa 96T
E0482p ELISA EDN1,Endothelin-1,ET-1,Pig,PPET1,Preproendothelin-1,Sus scrofa 96T
U0482p CLIA EDN1,Endothelin-1,ET-1,Pig,PPET1,Preproendothelin-1,Sus scrofa 96T
U0482m CLIA Edn1,Endothelin-1,ET-1,Mouse,Mus musculus,PPET1,Preproendothelin-1 96T
E0482b ELISA kit Bos taurus,Bovine,EDN1,Endothelin-1,ET-1,PPET1,Preproendothelin-1 96T
EIAAB12433 EDN2,Endothelin-2,ET-2,Oryctolagus cuniculus,PPET2,Preproendothelin-2,Rabbit
E0482m ELISA kit Edn1,Endothelin-1,ET-1,Mouse,Mus musculus,PPET1,Preproendothelin-1 96T
E0482r ELISA Edn1,Endothelin-1,ET-1,PPET1,Preproendothelin-1,Rat,Rattus norvegicus 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur