Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

FERM domain-containing protein 3 (Band 4.1-like protein 4O) (Ovary type protein 4.1) (4.1O)

 FRMD3_HUMAN             Reviewed;         597 AA.
A2A2Y4; A8MQB0; B4DN14; Q53EP2; Q5JV59; Q5VZA1; Q86WP8; Q8IZ44;
Q8N3Y5; Q8N9L2;
05-FEB-2008, integrated into UniProtKB/Swiss-Prot.
20-FEB-2007, sequence version 1.
25-OCT-2017, entry version 100.
RecName: Full=FERM domain-containing protein 3;
AltName: Full=Band 4.1-like protein 4O;
AltName: Full=Ovary type protein 4.1;
Short=4.1O;
Name=FRMD3; Synonyms=EPB41L4O;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY, AND
DEVELOPMENTAL STAGE.
TISSUE=Fetal brain;
PubMed=12601556; DOI=10.1007/s100380300015;
Ni X., Ji C., Cao G., Cheng H., Guo L., Gu S., Ying K., Zhao R.C.,
Mao Y.;
"Molecular cloning and characterization of the protein 4.1O gene, a
novel member of the protein 4.1 family with focal expression in
ovary.";
J. Hum. Genet. 48:101-106(2003).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 34-597 (ISOFORM 2).
TISSUE=Cerebellum;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164053; DOI=10.1038/nature02465;
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
Rogers J., Dunham I.;
"DNA sequence and analysis of human chromosome 9.";
Nature 429:369-374(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
TISSUE=Brain, and Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-597 (ISOFORM 1).
TISSUE=Kidney;
Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.;
Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases.
[8]
FUNCTION.
PubMed=17260017; DOI=10.1038/sj.onc.1210225;
Haase D., Meister M., Muley T., Hess J., Teurich S., Schnabel P.,
Hartenstein B., Angel P.;
"FRMD3, a novel putative tumour suppressor in NSCLC.";
Oncogene 26:4464-4468(2007).
-!- FUNCTION: Putative tumor suppressor gene that may be implicated in
the origin and progression of lung cancer.
{ECO:0000269|PubMed:17260017}.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass membrane
protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1;
IsoId=A2A2Y4-1; Sequence=Displayed;
Name=2;
IsoId=A2A2Y4-2; Sequence=VSP_031167;
Name=3;
IsoId=A2A2Y4-3; Sequence=VSP_031163, VSP_031165, VSP_031167;
Name=4;
IsoId=A2A2Y4-4; Sequence=VSP_031162, VSP_031166, VSP_031167;
Note=No experimental confirmation available.;
Name=5;
IsoId=A2A2Y4-5; Sequence=VSP_031164;
-!- TISSUE SPECIFICITY: Ovary-specific. {ECO:0000269|PubMed:12601556}.
-!- DEVELOPMENTAL STAGE: Expressed in skeletal muscle, lower levels in
thymus and brain. {ECO:0000269|PubMed:12601556}.
-!- SEQUENCE CAUTION:
Sequence=BAC04321.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=EAW62650.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY137774; AAN52119.1; -; mRNA.
EMBL; AK094281; BAC04321.1; ALT_INIT; mRNA.
EMBL; AK297722; BAG60076.1; -; mRNA.
EMBL; EF560742; ABQ59052.1; -; mRNA.
EMBL; AL161786; CAH72749.1; -; Genomic_DNA.
EMBL; AL137847; CAH72749.1; JOINED; Genomic_DNA.
EMBL; AL161786; CAH72750.2; -; Genomic_DNA.
EMBL; AL137847; CAH72750.2; JOINED; Genomic_DNA.
EMBL; AL450026; CAH72750.2; JOINED; Genomic_DNA.
EMBL; AL137847; CAI40734.1; -; Genomic_DNA.
EMBL; AL161786; CAI40734.1; JOINED; Genomic_DNA.
EMBL; AL137847; CAI40735.2; -; Genomic_DNA.
EMBL; AL161786; CAI40735.2; JOINED; Genomic_DNA.
EMBL; AL450026; CAI40735.2; JOINED; Genomic_DNA.
EMBL; AL137847; CAI40736.1; -; Genomic_DNA.
EMBL; AL161786; CAM17460.1; -; Genomic_DNA.
EMBL; AL137847; CAM17460.1; JOINED; Genomic_DNA.
EMBL; AL450026; CAM17460.1; JOINED; Genomic_DNA.
EMBL; AL450026; CAM19643.1; -; Genomic_DNA.
EMBL; AL137847; CAM19643.1; JOINED; Genomic_DNA.
EMBL; AL161786; CAM19643.1; JOINED; Genomic_DNA.
EMBL; AL450026; CAM19644.1; -; Genomic_DNA.
EMBL; AL137847; CAM19644.1; JOINED; Genomic_DNA.
EMBL; AL161786; CAM19644.1; JOINED; Genomic_DNA.
EMBL; AL137847; CAM19673.1; -; Genomic_DNA.
EMBL; AL161786; CAM19673.1; JOINED; Genomic_DNA.
EMBL; AL450026; CAM19673.1; JOINED; Genomic_DNA.
EMBL; CH471089; EAW62647.1; -; Genomic_DNA.
EMBL; CH471089; EAW62649.1; -; Genomic_DNA.
EMBL; CH471089; EAW62650.1; ALT_INIT; Genomic_DNA.
EMBL; CH471089; EAW62651.1; -; Genomic_DNA.
EMBL; BC023560; AAH23560.1; -; mRNA.
EMBL; BC037253; AAH37253.1; -; mRNA.
EMBL; AK223597; BAD97317.1; -; mRNA.
CCDS; CCDS43840.1; -. [A2A2Y4-1]
CCDS; CCDS59131.1; -. [A2A2Y4-4]
CCDS; CCDS59132.1; -. [A2A2Y4-3]
CCDS; CCDS59133.1; -. [A2A2Y4-2]
CCDS; CCDS75852.1; -. [A2A2Y4-5]
RefSeq; NP_001231888.1; NM_001244959.1. [A2A2Y4-2]
RefSeq; NP_001231889.1; NM_001244960.1. [A2A2Y4-5]
RefSeq; NP_001231890.1; NM_001244961.1. [A2A2Y4-3]
RefSeq; NP_001231891.1; NM_001244962.1. [A2A2Y4-4]
RefSeq; NP_777598.3; NM_174938.5. [A2A2Y4-1]
UniGene; Hs.127535; -.
UniGene; Hs.743606; -.
ProteinModelPortal; A2A2Y4; -.
SMR; A2A2Y4; -.
BioGrid; 129190; 12.
IntAct; A2A2Y4; 16.
STRING; 9606.ENSP00000303508; -.
iPTMnet; A2A2Y4; -.
PhosphoSitePlus; A2A2Y4; -.
BioMuta; FRMD3; -.
MaxQB; A2A2Y4; -.
PaxDb; A2A2Y4; -.
PRIDE; A2A2Y4; -.
DNASU; 257019; -.
Ensembl; ENST00000304195; ENSP00000303508; ENSG00000172159. [A2A2Y4-1]
Ensembl; ENST00000328788; ENSP00000328615; ENSG00000172159. [A2A2Y4-4]
Ensembl; ENST00000376434; ENSP00000365617; ENSG00000172159. [A2A2Y4-3]
Ensembl; ENST00000376438; ENSP00000365621; ENSG00000172159. [A2A2Y4-2]
Ensembl; ENST00000621208; ENSP00000484839; ENSG00000172159. [A2A2Y4-5]
GeneID; 257019; -.
KEGG; hsa:257019; -.
UCSC; uc004amq.1; human. [A2A2Y4-1]
CTD; 257019; -.
DisGeNET; 257019; -.
EuPathDB; HostDB:ENSG00000172159.15; -.
GeneCards; FRMD3; -.
H-InvDB; HIX0023043; -.
HGNC; HGNC:24125; FRMD3.
HPA; HPA017285; -.
MIM; 607619; gene.
neXtProt; NX_A2A2Y4; -.
OpenTargets; ENSG00000172159; -.
PharmGKB; PA134903920; -.
eggNOG; KOG3530; Eukaryota.
eggNOG; ENOG410XSWH; LUCA.
GeneTree; ENSGT00760000118823; -.
HOVERGEN; HBG057180; -.
InParanoid; A2A2Y4; -.
OMA; FLCEIRQ; -.
OrthoDB; EOG091G06EA; -.
PhylomeDB; A2A2Y4; -.
TreeFam; TF343477; -.
ChiTaRS; FRMD3; human.
GenomeRNAi; 257019; -.
PRO; PR:A2A2Y4; -.
Proteomes; UP000005640; Chromosome 9.
Bgee; ENSG00000172159; -.
ExpressionAtlas; A2A2Y4; baseline and differential.
Genevisible; A2A2Y4; HS.
GO; GO:0005856; C:cytoskeleton; IBA:GO_Central.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0008092; F:cytoskeletal protein binding; IEA:InterPro.
GO; GO:0005200; F:structural constituent of cytoskeleton; IBA:GO_Central.
GO; GO:0031032; P:actomyosin structure organization; IBA:GO_Central.
CDD; cd14473; FERM_B-lobe; 1.
Gene3D; 1.20.80.10; -; 1.
Gene3D; 2.30.29.30; -; 1.
InterPro; IPR019749; Band_41_domain.
InterPro; IPR000798; Ez/rad/moesin-like.
InterPro; IPR014847; FERM-adjacent.
InterPro; IPR014352; FERM/acyl-CoA-bd_prot_3-hlx.
InterPro; IPR035963; FERM_2.
InterPro; IPR019748; FERM_central.
InterPro; IPR019747; FERM_CS.
InterPro; IPR000299; FERM_domain.
InterPro; IPR018979; FERM_N.
InterPro; IPR018980; FERM_PH-like_C.
InterPro; IPR011993; PH_dom-like.
InterPro; IPR029071; Ubiquitin-rel_dom.
Pfam; PF08736; FA; 1.
Pfam; PF09380; FERM_C; 1.
Pfam; PF00373; FERM_M; 1.
Pfam; PF09379; FERM_N; 1.
PRINTS; PR00935; BAND41.
PRINTS; PR00661; ERMFAMILY.
SMART; SM00295; B41; 1.
SMART; SM01195; FA; 1.
SMART; SM01196; FERM_C; 1.
SUPFAM; SSF47031; SSF47031; 1.
SUPFAM; SSF50729; SSF50729; 1.
SUPFAM; SSF54236; SSF54236; 1.
PROSITE; PS00660; FERM_1; 1.
PROSITE; PS50057; FERM_3; 1.
2: Evidence at transcript level;
Alternative splicing; Complete proteome; Membrane; Polymorphism;
Reference proteome; Transmembrane; Transmembrane helix.
CHAIN 1 597 FERM domain-containing protein 3.
/FTId=PRO_0000318098.
TRANSMEM 531 551 Helical. {ECO:0000255}.
DOMAIN 32 312 FERM. {ECO:0000255|PROSITE-
ProRule:PRU00084}.
VAR_SEQ 1 344 Missing (in isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_031162.
VAR_SEQ 1 194 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_031163.
VAR_SEQ 1 49 MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDD
SEISCHIQ -> MQLSK (in isoform 5).
{ECO:0000303|PubMed:12601556}.
/FTId=VSP_031164.
VAR_SEQ 195 198 KNEL -> MVFR (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_031165.
VAR_SEQ 345 398 SSKIQREPPEVHRANITQSRSSHSLNKQLIINMEPLQPLLP
SPSEQEEELPLGE -> MQAEETKGIGITSMAKCLVKIQTR
RSLQLHMVNHCNSNVFVRLLRLGSKVTARNT (in
isoform 4).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_031166.
VAR_SEQ 553 597 GIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYM
LGCS -> VSMQ (in isoform 2, isoform 3 and
isoform 4). {ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_031167.
VARIANT 485 485 D -> Y (in dbSNP:rs4877747).
/FTId=VAR_048366.
CONFLICT 248 248 Q -> R (in Ref. 1; AAN52119).
{ECO:0000305}.
CONFLICT 554 554 I -> V (in Ref. 1; AAN52119).
{ECO:0000305}.
SEQUENCE 597 AA; 68772 MW; 0B11ABBDDDE0AE67 CRC64;
MFASCHCVPR GRRTMKMIHF RSSSVKSLSQ EMRCTIRLLD DSEISCHIQR ETKGQFLIDH
ICNYYSLLEK DYFGIRYVDP EKQRHWLEPN KSIFKQMKTH PPYTMCFRVK FYPHEPLKIK
EELTRYLLYL QIKRDIFHGR LLCSFSDAAY LGACIVQAEL GDYDPDEHPE NYISEFEIFP
KQSQKLERKI VEIHKNELRG QSPPVAEFNL LLKAHTLETY GVDPHPCKDS TGTTTFLGFT
AAGFVVFQGN KRIHLIKWPD VCKLKFEGKT FYVIGTQKEK KAMLAFHTST PAACKHLWKC
GVENQAFYKY AKSSQIKTVS SSKIFFKGSR FRYSGKVAKE VVEASSKIQR EPPEVHRANI
TQSRSSHSLN KQLIINMEPL QPLLPSPSEQ EEELPLGEGV PLPKEENISA PLISSSPVKA
AREYEDPPSE EEDKIKEEPL TISELVYNPS ASLLPTPVDD DEIDMLFDCP SRLELEREDT
DSFEDLEADE NAFLIAEEEE LKEARRALSW SYDILTGHIR VNPLVKSFSR LLVVGLGLLL
FVFPLLLLLL ESGIDLSFLC EIRQTPEFEQ FHYEYYCPLK EWVAGKVHLI LYMLGCS


Related products :

Catalog number Product name Quantity
EIAAB12287 Band 4.1-like protein 4B,EHM2,EPB41L4B,FERM-containing protein CG1,Homo sapiens,Human,Protein EHM2
EIAAB14441 FARP2,FERM domain including RhoGEF,FERM, RhoGEF and pleckstrin domain-containing protein 2,FIR,Homo sapiens,Human,KIAA0793,PH domain-containing family C member 3,Pleckstrin homology domain-containing
EIAAB14442 Farp2,FERM domain including RhoGEF,FERM, RhoGEF and pleckstrin domain-containing protein 2,FIR,Kiaa0793,Mouse,Mus musculus
EIAAB14440 CDEP,Chondrocyte-derived ezrin-like protein,FARP1,FERM, RhoGEF and pleckstrin domain-containing protein 1,Homo sapiens,Human,PH domain-containing family C member 2,Pleckstrin homology domain-containin
E8193h Human FERM And PDZ Domain Containing Protein 4 ELI 96T
E3504h Human FERM And PDZ Domain Containing Protein 2 ELI 96T
E8194h Human FERM And PDZ Domain Containing Protein 3 ELI 96T
E7593h Human FERM And PDZ Domain Containing Protein 1 ELI 96T
CSB-EL008428HU Human FERM, RhoGEF and pleckstrin domain protein 2 (FARP2) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL008428MO Mouse FERM, RhoGEF and pleckstrin domain protein 2 (FARP2) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL008994RA Rat FERM domain-containing protein 6(FRMD6) ELISA kit 96T
E8191h Human FERM Domain Containing Protein 5 ELISA Kit 96T
ABHD4_MOUSE Human ELISA Kit FOR FERM domain-containing protein 6 96T
E6988h Human FERM Domain Containing Protein 4B ELISA Kit 96T
CSB-EL008996RA Rat FERM domain-containing protein 8(FRMD8) ELISA kit 96T
E0008m Human ELISA Kit FOR FERM and PDZ domain-containing protein 2 96T
E6508h Human FERM Domain Containing Protein 6 ELISA Kit 96T
PF21A_HUMAN Human ELISA Kit FOR FERM and PDZ domain-containing protein 2 96T
E0222r Human ELISA Kit FOR FERM domain-containing protein 6 96T
FRPD4_MOUSE Mouse ELISA Kit FOR FERM and PDZ domain-containing protein 4 96T
COE1_HUMAN Human ELISA Kit FOR FERM and PDZ domain-containing protein 2 96T
FRMD1_HUMAN Human ELISA Kit FOR FERM domain-containing protein 1 96T
E8192h Human FERM Domain Containing Protein 1 ELISA Kit 96T
E4343h Human FERM Domain Containing Protein 3 ELISA Kit 96T
FRM4A_MOUSE Mouse ELISA Kit FOR FERM domain-containing protein 4A 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur