Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Fas apoptotic inhibitory molecule 3 (IgM Fc fragment receptor) (Regulator of Fas-induced apoptosis Toso)

 FAIM3_HUMAN             Reviewed;         390 AA.
O60667; A8K7J2; B7Z6Z0; D9MWM3;
17-APR-2007, integrated into UniProtKB/Swiss-Prot.
01-AUG-1998, sequence version 1.
15-MAR-2017, entry version 141.
RecName: Full=Fas apoptotic inhibitory molecule 3 {ECO:0000305};
AltName: Full=IgM Fc fragment receptor {ECO:0000312|HGNC:HGNC:14315};
AltName: Full=Regulator of Fas-induced apoptosis Toso {ECO:0000303|PubMed:9586636};
Flags: Precursor;
Name=FCMR {ECO:0000312|HGNC:HGNC:14315}; Synonyms=FAIM3, TOSO;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY,
AND INDUCTION.
PubMed=9586636; DOI=10.1016/S1074-7613(00)80551-8;
Hitoshi Y., Lorens J., Kitada S., Fisher J., LaBarge M., Ring H.Z.,
Francke U., Reed J.C., Kinoshita S., Nolan G.P.;
"Toso, a cell surface, specific regulator of Fas-induced apoptosis in
T cells.";
Immunity 8:461-471(1998).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), IDENTIFICATION BY MASS
SPECTROMETRY, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=21908424; DOI=10.1182/blood-2011-04-350793;
Li F.J., Kubagawa Y., McCollum M.K., Wilson L., Motohashi T.,
Bertoli L.F., Barton J.C., Barnes S., Davis R.S., Kubagawa H.;
"Enhanced levels of both the membrane-bound and soluble forms of IgM
Fc receptor (Fc?R) in patients with chronic lymphocytic leukemia.";
Blood 118:4902-4909(2011).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Spleen;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=B-cell;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: May play a role in the immune system processes. Protects
cells from FAS-, TNF alpha- and FADD-induced apoptosis without
increasing expression of the inhibitors of apoptosis BCL2 and
BCLXL. Seems to activate an inhibitory pathway that prevents CASP8
activation following FAS stimulation, rather than blocking
apoptotic signals downstream. May inhibit FAS-induced apoptosis by
preventing CASP8 processing through CFLAR up-regulation.
{ECO:0000269|PubMed:9586636}.
-!- SUBCELLULAR LOCATION: Isoform 1: Membrane
{ECO:0000269|PubMed:21908424}; Single-pass membrane protein
{ECO:0000255}.
-!- SUBCELLULAR LOCATION: Isoform 3: Secreted
{ECO:0000269|PubMed:21908424}. Note=Detected in the serum.
{ECO:0000269|PubMed:21908424}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=O60667-1; Sequence=Displayed;
Name=2;
IsoId=O60667-2; Sequence=VSP_042947;
Note=No experimental confirmation available.;
Name=3;
IsoId=O60667-3; Sequence=VSP_045188, VSP_045189;
-!- TISSUE SPECIFICITY: Expressed in lymph nodes, peripheral blood
leukocytes, lung, thymus and kidneys. Very weak expression
detected in spleen, liver, heart, and salivary gland. Expressed in
lymphoid cell lines such as Jurkat, CEM-T4, MOLT-4, HB11;19 and
Reh. No expression detected in nonhematopoietic cell lines
including Hep-G2, HEK293 and HeLa. Detected at high levels in
chronic lymphocytic leukemia cells. {ECO:0000269|PubMed:21908424,
ECO:0000269|PubMed:9586636}.
-!- INDUCTION: By T-cell activation. {ECO:0000269|PubMed:9586636}.
-!- DOMAIN: The Ig-like domain is required for the anti-apoptotic
ability.
-!- MISCELLANEOUS: 'Toso' is a Japanese liquor drunk on New Year's day
to celebrate long life and eternal youth.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF057557; AAC18830.1; -; mRNA.
EMBL; HM480394; ADK11426.1; -; mRNA.
EMBL; BT006797; AAP35443.1; -; mRNA.
EMBL; AK292007; BAF84696.1; -; mRNA.
EMBL; AK301187; BAH13426.1; -; mRNA.
EMBL; AK316336; BAH14707.1; -; mRNA.
EMBL; AC098935; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471100; EAW93517.1; -; Genomic_DNA.
EMBL; BC006401; AAH06401.1; -; mRNA.
CCDS; CCDS1473.1; -. [O60667-1]
CCDS; CCDS44304.1; -. [O60667-2]
CCDS; CCDS53467.1; -. [O60667-3]
RefSeq; NP_001135945.1; NM_001142473.1. [O60667-2]
RefSeq; NP_001180267.1; NM_001193338.1. [O60667-3]
RefSeq; NP_005440.1; NM_005449.4. [O60667-1]
UniGene; Hs.58831; -.
UniGene; Hs.744273; -.
ProteinModelPortal; O60667; -.
SMR; O60667; -.
BioGrid; 114648; 3.
IntAct; O60667; 1.
STRING; 9606.ENSP00000356058; -.
iPTMnet; O60667; -.
PhosphoSitePlus; O60667; -.
BioMuta; FAIM3; -.
PaxDb; O60667; -.
PeptideAtlas; O60667; -.
PRIDE; O60667; -.
DNASU; 9214; -.
Ensembl; ENST00000367091; ENSP00000356058; ENSG00000162894. [O60667-1]
Ensembl; ENST00000442471; ENSP00000404136; ENSG00000162894. [O60667-2]
Ensembl; ENST00000628511; ENSP00000485739; ENSG00000162894. [O60667-3]
GeneID; 9214; -.
KEGG; hsa:9214; -.
UCSC; uc001hey.4; human. [O60667-1]
CTD; 9214; -.
DisGeNET; 9214; -.
GeneCards; FCMR; -.
HGNC; HGNC:14315; FCMR.
HPA; HPA003910; -.
MIM; 606015; gene.
neXtProt; NX_O60667; -.
OpenTargets; ENSG00000162894; -.
PharmGKB; PA142671899; -.
eggNOG; ENOG410IJ2J; Eukaryota.
eggNOG; ENOG41113GQ; LUCA.
GeneTree; ENSGT00530000063436; -.
HOGENOM; HOG000013142; -.
HOVERGEN; HBG107910; -.
InParanoid; O60667; -.
OMA; TIECPLP; -.
OrthoDB; EOG091G0K4T; -.
PhylomeDB; O60667; -.
TreeFam; TF338713; -.
ChiTaRS; FAIM3; human.
GenomeRNAi; 9214; -.
PRO; PR:O60667; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000162894; -.
CleanEx; HS_FAIM3; -.
ExpressionAtlas; O60667; baseline and differential.
Genevisible; O60667; HS.
GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0006968; P:cellular defense response; TAS:ProtInc.
GO; GO:0002376; P:immune system process; IEA:UniProtKB-KW.
GO; GO:0043066; P:negative regulation of apoptotic process; TAS:ProtInc.
Gene3D; 2.60.40.10; -; 1.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
InterPro; IPR013106; Ig_V-set.
Pfam; PF07686; V-set; 1.
SMART; SM00409; IG; 1.
SUPFAM; SSF48726; SSF48726; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Disulfide bond; Immunity;
Immunoglobulin domain; Membrane; Phosphoprotein; Reference proteome;
Secreted; Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 17 {ECO:0000255}.
CHAIN 18 390 Fas apoptotic inhibitory molecule 3.
/FTId=PRO_0000284421.
TOPO_DOM 18 251 Extracellular. {ECO:0000255}.
TRANSMEM 252 272 Helical. {ECO:0000255}.
TOPO_DOM 273 390 Cytoplasmic. {ECO:0000255}.
DOMAIN 33 105 Ig-like.
COMPBIAS 274 323 Arg-rich.
MOD_RES 92 92 Phosphothreonine.
{ECO:0000250|UniProtKB:Q5M871}.
DISULFID 37 104 {ECO:0000250}.
VAR_SEQ 13 124 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_042947.
VAR_SEQ 237 245 RALDYGSQS -> SPLQAGPPT (in isoform 3).
{ECO:0000303|PubMed:21908424}.
/FTId=VSP_045188.
VAR_SEQ 249 390 GQGFHILIPTILGLFLLALLGLVVKRAVERRKALSRRARRL
AVRMRALESSQRPRGSPRPRSQNNIYSACPRRARGADAAGT
GEAPVPGPGAPLPPAPLQVSESPWLHAPSLKTSCEYVSLYH
QPAAMMEDSDSDDYINVPA -> DARPGELPEAPRVAATAL
PKQHLQRLPAARSWSGRCRHRGGPRSRPRSAVAPRPAAGV
(in isoform 3).
{ECO:0000303|PubMed:21908424}.
/FTId=VSP_045189.
SEQUENCE 390 AA; 43146 MW; FE91D217EECA99C6 CRC64;
MDFWLWPLYF LPVSGALRIL PEVKVEGELG GSVTIKCPLP EMHVRIYLCR EMAGSGTCGT
VVSTTNFIKA EYKGRVTLKQ YPRKNLFLVE VTQLTESDSG VYACGAGMNT DRGKTQKVTL
NVHSEYEPSW EEQPMPETPK WFHLPYLFQM PAYASSSKFV TRVTTPAQRG KVPPVHHSSP
TTQITHRPRV SRASSVAGDK PRTFLPSTTA SKISALEGLL KPQTPSYNHH TRLHRQRALD
YGSQSGREGQ GFHILIPTIL GLFLLALLGL VVKRAVERRK ALSRRARRLA VRMRALESSQ
RPRGSPRPRS QNNIYSACPR RARGADAAGT GEAPVPGPGA PLPPAPLQVS ESPWLHAPSL
KTSCEYVSLY HQPAAMMEDS DSDDYINVPA


Related products :

Catalog number Product name Quantity
EIAAB14365 Faim3,Fas apoptotic inhibitory molecule 3,Rat,Rattus norvegicus,Regulator of Fas-induced apoptosis Toso,Toso
EIAAB14366 Faim3,Fas apoptotic inhibitory molecule 3,Mouse,Mus musculus,Regulator of Fas-induced apoptosis Toso,Toso
EIAAB14367 FAIM3,Fas apoptotic inhibitory molecule 3,Homo sapiens,Human,Regulator of Fas-induced apoptosis Toso,TOSO
18-783-75566 RABBIT ANTI HUMAN TOSO (C-TERMINAL) - FAIM3; Regulator of Fas-induced apoptosis Toso Polyclonal 0.1 mg
GWB-612890 Regulator Of Fas-induced Apoptosis (TOSO) (FAIM3) Rabbit anti-Human Polyclonal (C-Terminus) Antibody
E10214m Rat ELISA Kit FOR Fas apoptotic inhibitory molecule 2 96T
EH3035 Fas Apoptotic Inhibitory Molecule 3 Elisa Kit 96T
201-20-1946 FAIM{Fas apoptotic inhibitory molecule}rabbit.pAb 0.2ml
CSB-EL007971RA Rat Fas apoptotic inhibitory molecule 2(FAIM2) ELISA kit 96T
FAM100B FAIM3 Gene Fas apoptotic inhibitory molecule 3
CSB-EL007972RA Rat Fas apoptotic inhibitory molecule 3(FAIM3) ELISA kit 96T
FAIM2_HUMAN Human ELISA Kit FOR Fas apoptotic inhibitory molecule 2 96T
CSB-EL007970RA Rat Fas apoptotic inhibitory molecule 1(FAIM) ELISA kit 96T
E14776h Human Fas Apoptotic Inhibitory Molecule 2 ELISA Ki 96T
FAM100A FAIM2 Gene Fas apoptotic inhibitory molecule 2
FAIM3 FAIM Gene Fas apoptotic inhibitory molecule
CSB-EL007970MO Mouse Fas apoptotic inhibitory molecule 1(FAIM) ELISA kit 96T
abx108239 Polyclonal Rabbit Fas apoptotic inhibitory molecule 3 Antibody (HRP) 100 μg
CSB-EL007972MO Mouse Fas apoptotic inhibitory molecule 3(FAIM3) ELISA kit 96T
CSB-EL007970RA Rat Fas apoptotic inhibitory molecule 1(FAIM) ELISA kit SpeciesRat 96T
EIAAB14359 Bos taurus,Bovine,FAIM,Fas apoptotic inhibitory molecule 1
CSB-EL007971BO Bovine Fas apoptotic inhibitory molecule 2(FAIM2) ELISA kit 96T
abx109287 Polyclonal Rabbit Fas apoptotic inhibitory molecule 3 Antibody 100 μg
CSB-EL007972RA Rat Fas apoptotic inhibitory molecule 3(FAIM3) ELISA kit SpeciesRat 96T
CSB-EL007970BO Bovine Fas apoptotic inhibitory molecule 1(FAIM) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur