Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Fc receptor-like A (Fc receptor homolog expressed in B-cells) (Fc receptor-like and mucin-like protein 1) (Fc receptor-like protein) (Fc receptor-related protein X) (FcRX)

 FCRLA_HUMAN             Reviewed;         359 AA.
Q7L513; A0N0M1; A6NC03; A6NL20; F5H720; F8W743; G3V1J2; Q5VXA1;
Q5VXA2; Q5VXA3; Q5VXA4; Q5VXB0; Q5VXB1; Q8NEW4; Q8WXH3; Q96PC6;
Q96PJ0; Q96PJ1; Q96PJ2; Q96PJ4; Q9BR57;
21-MAR-2006, integrated into UniProtKB/Swiss-Prot.
21-MAR-2006, sequence version 2.
10-OCT-2018, entry version 127.
RecName: Full=Fc receptor-like A;
AltName: Full=Fc receptor homolog expressed in B-cells;
AltName: Full=Fc receptor-like and mucin-like protein 1;
AltName: Full=Fc receptor-like protein;
AltName: Full=Fc receptor-related protein X;
Short=FcRX;
Flags: Precursor;
Name=FCRLA; Synonyms=FCRL, FCRL1, FCRLM1, FCRX, FREB;
ORFNames=UNQ291/PRO329;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3; 4; 5; 6 AND 7), FUNCTION,
SUBCELLULAR LOCATION, TISSUE SPECIFICITY, AND VARIANT GLN-349.
TISSUE=Lymph, Melanocyte, and Tonsil;
PubMed=11754007;
DOI=10.1002/1521-4141(200201)32:1<87::AID-IMMU87>3.0.CO;2-#;
Mechetina L.V., Najakshin A.M., Volkova O.Y., Guselnikov S.V.,
Faizulin R.Z., Alabyev B.Y., Chikaev N.A., Vinogradova M.S.,
Taranin A.V.;
"FCRL, a novel member of the leukocyte Fc receptor family possesses
unique structural features.";
Eur. J. Immunol. 32:87-96(2002).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 9), FUNCTION, SUBCELLULAR
LOCATION, TISSUE SPECIFICITY, AND VARIANT GLN-349.
PubMed=11891275; DOI=10.1073/pnas.022042699;
Facchetti F., Cella M., Festa S., Fremont D.H., Colonna M.;
"An unusual Fc receptor-related protein expressed in human
centroblasts.";
Proc. Natl. Acad. Sci. U.S.A. 99:3776-3781(2002).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 9), TISSUE SPECIFICITY, AND
VARIANT GLN-349.
PubMed=12202404; DOI=10.1093/intimm/dxf074;
Davis R.S., Li H., Chen C.-C., Wang Y.-H., Cooper M.D., Burrows P.D.;
"Definition of an Fc receptor-related gene (FcRX) expressed in human
and mouse B cells.";
Int. Immunol. 14:1075-1083(2002).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3; 5; 6; 7 AND 8), TISSUE
SPECIFICITY, AND SUBCELLULAR LOCATION.
TISSUE=Melanocyte;
PubMed=15551350; DOI=10.1002/ijc.20735;
Inozume T., Matsuzaki Y., Kurihara S., Fujita T., Yamamoto A.,
Aburatani H., Shimada S., Kawakami Y.;
"Novel melanoma antigen, FCRL/FREB, identified by cDNA profile
comparison using DNA chip are immunogenic in multiple melanoma
patients.";
Int. J. Cancer 114:283-290(2005).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND VARIANT GLN-349.
TISSUE=Tonsil;
Guselnikov S., Najakshin A.M.;
Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B.,
Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O.,
Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I.,
Nickerson D.A.;
Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 9), AND VARIANT
GLN-349.
TISSUE=Lymph, and Tonsil;
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
GLN-349.
TISSUE=Skin;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[11]
PROTEIN SEQUENCE OF 28-42.
PubMed=15340161; DOI=10.1110/ps.04682504;
Zhang Z., Henzel W.J.;
"Signal peptide prediction based on analysis of experimentally
verified cleavage sites.";
Protein Sci. 13:2819-2824(2004).
[12]
PROTEIN SEQUENCE OF 88-98; 252-259 AND 333-353, AND IDENTIFICATION BY
MASS SPECTROMETRY.
TISSUE=B-cell lymphoma;
Bienvenut W.V.;
Submitted (JUN-2005) to UniProtKB.
[13]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
-!- FUNCTION: May be implicated in B-cell differentiation and
lymphomagenesis. {ECO:0000269|PubMed:11754007,
ECO:0000269|PubMed:11891275}.
-!- SUBUNIT: Monomer or homodimer; disulfide-linked.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:11754007,
ECO:0000269|PubMed:11891275, ECO:0000269|PubMed:15551350}.
Note=Seems not to be secreted. {ECO:0000269|PubMed:11891275}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=15;
Name=1; Synonyms=FCRLa;
IsoId=Q7L513-1; Sequence=Displayed;
Name=2; Synonyms=FCRLa1;
IsoId=Q7L513-2; Sequence=VSP_017605;
Name=3; Synonyms=FCRLb;
IsoId=Q7L513-3; Sequence=VSP_017608;
Name=4; Synonyms=FCRLc1;
IsoId=Q7L513-4; Sequence=VSP_017606;
Name=5; Synonyms=FCRLc2;
IsoId=Q7L513-5; Sequence=VSP_017604;
Name=6; Synonyms=FCRLd;
IsoId=Q7L513-6; Sequence=VSP_017607;
Name=7; Synonyms=FCRLe;
IsoId=Q7L513-7; Sequence=VSP_017603;
Name=8; Synonyms=FCRLf;
IsoId=Q7L513-8; Sequence=VSP_017609;
Name=9;
IsoId=Q7L513-9; Sequence=VSP_038297;
Name=10;
IsoId=Q7L513-10; Sequence=VSP_038297, VSP_017605;
Note=No experimental confirmation available.;
Name=11;
IsoId=Q7L513-11; Sequence=VSP_038297, VSP_017606;
Note=No experimental confirmation available.;
Name=12;
IsoId=Q7L513-12; Sequence=VSP_038297, VSP_017608;
Note=No experimental confirmation available.;
Name=13;
IsoId=Q7L513-13; Sequence=VSP_038297, VSP_017607;
Note=No experimental confirmation available.;
Name=14;
IsoId=Q7L513-14; Sequence=VSP_038297, VSP_017604;
Note=No experimental confirmation available.;
Name=15;
IsoId=Q7L513-15; Sequence=VSP_038297, VSP_017603;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed specifically in primary and
secondary lymphoid tissues like lymph node, spleen and tonsil.
Specifically expressed in B-cells with a high level in normal
germinal center B-cells, centroblasts and in a subset of diffuse
large B-cell lymphomas. Highly expressed in bone marrow B-cells
and weakly in earlier B lineage cells. Expressed in pre-germinal
and germinal center B-cells in secondary lymphoid tissues. Also
expressed in melanoma and melanocytes.
{ECO:0000269|PubMed:11754007, ECO:0000269|PubMed:11891275,
ECO:0000269|PubMed:12202404, ECO:0000269|PubMed:15551350}.
-!- CAUTION: It is uncertain whether Met-1 or Met-8 is the initiator.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF329489; AAL23899.1; -; mRNA.
EMBL; AF329491; AAL23901.1; -; mRNA.
EMBL; AF329493; AAL23903.1; -; mRNA.
EMBL; AF329494; AAL23904.1; -; mRNA.
EMBL; AF329495; AAL23905.1; -; mRNA.
EMBL; AF390036; AAL27307.1; -; mRNA.
EMBL; AF426461; AAL58111.1; -; mRNA.
EMBL; AF531423; AAM97591.1; -; mRNA.
EMBL; AY091642; AAM13980.2; -; mRNA.
EMBL; EF064729; ABK41912.1; -; Genomic_DNA.
EMBL; AY358348; AAQ88714.1; -; mRNA.
EMBL; AL359541; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471067; EAW90683.1; -; Genomic_DNA.
EMBL; CH471067; EAW90684.1; -; Genomic_DNA.
EMBL; CH471067; EAW90685.1; -; Genomic_DNA.
EMBL; BC006521; AAH06521.2; -; mRNA.
CCDS; CCDS30926.1; -. [Q7L513-9]
CCDS; CCDS53415.1; -. [Q7L513-10]
CCDS; CCDS53416.1; -. [Q7L513-11]
CCDS; CCDS53417.1; -. [Q7L513-12]
CCDS; CCDS53418.1; -. [Q7L513-13]
CCDS; CCDS53419.1; -. [Q7L513-14]
CCDS; CCDS53420.1; -. [Q7L513-15]
RefSeq; NP_001171795.1; NM_001184866.1. [Q7L513-10]
RefSeq; NP_001171796.1; NM_001184867.1. [Q7L513-12]
RefSeq; NP_001171799.1; NM_001184870.1. [Q7L513-11]
RefSeq; NP_001171800.1; NM_001184871.1. [Q7L513-15]
RefSeq; NP_001171801.1; NM_001184872.1. [Q7L513-14]
RefSeq; NP_001171802.1; NM_001184873.1. [Q7L513-13]
RefSeq; NP_116127.3; NM_032738.3. [Q7L513-9]
UniGene; Hs.266331; -.
PDB; 4HWN; X-ray; 2.01 A; A=169-264.
PDBsum; 4HWN; -.
ProteinModelPortal; Q7L513; -.
SMR; Q7L513; -.
BioGrid; 124282; 1.
IntAct; Q7L513; 4.
STRING; 9606.ENSP00000356936; -.
iPTMnet; Q7L513; -.
PhosphoSitePlus; Q7L513; -.
BioMuta; FCRLA; -.
DMDM; 90101291; -.
MaxQB; Q7L513; -.
PaxDb; Q7L513; -.
PeptideAtlas; Q7L513; -.
PRIDE; Q7L513; -.
ProteomicsDB; 68782; -.
ProteomicsDB; 68783; -. [Q7L513-2]
ProteomicsDB; 68784; -. [Q7L513-3]
ProteomicsDB; 68785; -. [Q7L513-4]
ProteomicsDB; 68786; -. [Q7L513-5]
ProteomicsDB; 68787; -. [Q7L513-6]
ProteomicsDB; 68788; -. [Q7L513-7]
ProteomicsDB; 68789; -. [Q7L513-8]
ProteomicsDB; 68790; -. [Q7L513-9]
DNASU; 84824; -.
Ensembl; ENST00000236938; ENSP00000236938; ENSG00000132185. [Q7L513-9]
Ensembl; ENST00000294796; ENSP00000294796; ENSG00000132185. [Q7L513-4]
Ensembl; ENST00000309691; ENSP00000309596; ENSG00000132185. [Q7L513-3]
Ensembl; ENST00000349527; ENSP00000294798; ENSG00000132185. [Q7L513-8]
Ensembl; ENST00000350710; ENSP00000344808; ENSG00000132185. [Q7L513-15]
Ensembl; ENST00000367949; ENSP00000356926; ENSG00000132185. [Q7L513-13]
Ensembl; ENST00000367953; ENSP00000356930; ENSG00000132185. [Q7L513-2]
Ensembl; ENST00000367957; ENSP00000356934; ENSG00000132185. [Q7L513-14]
Ensembl; ENST00000367959; ENSP00000356936; ENSG00000132185. [Q7L513-10]
Ensembl; ENST00000540521; ENSP00000442870; ENSG00000132185. [Q7L513-11]
Ensembl; ENST00000546024; ENSP00000439838; ENSG00000132185. [Q7L513-12]
GeneID; 84824; -.
KEGG; hsa:84824; -.
UCSC; uc001gbd.4; human. [Q7L513-1]
CTD; 84824; -.
DisGeNET; 84824; -.
EuPathDB; HostDB:ENSG00000132185.16; -.
GeneCards; FCRLA; -.
H-InvDB; HIX0001250; -.
HGNC; HGNC:18504; FCRLA.
HPA; CAB016545; -.
MIM; 606891; gene.
neXtProt; NX_Q7L513; -.
OpenTargets; ENSG00000132185; -.
PharmGKB; PA162388180; -.
eggNOG; ENOG410IHSR; Eukaryota.
eggNOG; ENOG4111EGY; LUCA.
GeneTree; ENSGT00760000119130; -.
HOGENOM; HOG000036934; -.
HOVERGEN; HBG059243; -.
InParanoid; Q7L513; -.
OMA; TLSCQTK; -.
OrthoDB; EOG091G0ETN; -.
PhylomeDB; Q7L513; -.
TreeFam; TF335097; -.
ChiTaRS; FCRLA; human.
GeneWiki; FCRLA; -.
GenomeRNAi; 84824; -.
PRO; PR:Q7L513; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000132185; Expressed in 104 organ(s), highest expression level in lymph node.
CleanEx; HS_FCRL1; -.
ExpressionAtlas; Q7L513; baseline and differential.
Genevisible; Q7L513; HS.
GO; GO:0005737; C:cytoplasm; IDA:MGI.
GO; GO:0030154; P:cell differentiation; IEA:UniProtKB-KW.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
Pfam; PF13895; Ig_2; 2.
SMART; SM00409; IG; 2.
SUPFAM; SSF48726; SSF48726; 2.
PROSITE; PS50835; IG_LIKE; 2.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome; Cytoplasm;
Differentiation; Direct protein sequencing; Disulfide bond;
Immunoglobulin domain; Polymorphism; Reference proteome; Repeat;
Signal.
SIGNAL 1 27 {ECO:0000269|PubMed:15340161}.
CHAIN 28 359 Fc receptor-like A.
/FTId=PRO_0000227935.
DOMAIN 70 159 Ig-like C2-type 1.
DOMAIN 170 257 Ig-like C2-type 2.
COMPBIAS 269 315 Pro-rich.
DISULFID 99 143 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 192 240 {ECO:0000255|PROSITE-ProRule:PRU00114}.
VAR_SEQ 1 1 M -> MLKKISVGVAGDLNTVTM (in isoform 9,
isoform 10, isoform 11, isoform 12,
isoform 13, isoform 14 and isoform 15).
{ECO:0000303|PubMed:11891275,
ECO:0000303|PubMed:12202404,
ECO:0000303|PubMed:12975309}.
/FTId=VSP_038297.
VAR_SEQ 27 261 Missing (in isoform 7 and isoform 15).
{ECO:0000303|PubMed:11754007,
ECO:0000303|PubMed:15551350}.
/FTId=VSP_017603.
VAR_SEQ 27 166 Missing (in isoform 5 and isoform 14).
{ECO:0000303|PubMed:11754007,
ECO:0000303|PubMed:15551350}.
/FTId=VSP_017604.
VAR_SEQ 28 28 A -> AGCHAAA (in isoform 2 and isoform
10). {ECO:0000303|Ref.5}.
/FTId=VSP_017605.
VAR_SEQ 29 166 SFETLQCEGPVCTEESSCHTEDDLTDAREAGFQVKAYTFSE
PFHLIVSYDWLILQGPAKPVFEGDLLVLRCQAWQDWPLTQV
TFYRDGSALGPPGPNREFSITVVQKADSGHYHCSGIFQSPG
PGIPETASVVAITVQ -> GCHA (in isoform 4 and
isoform 11).
{ECO:0000303|PubMed:11754007}.
/FTId=VSP_017606.
VAR_SEQ 78 261 Missing (in isoform 6 and isoform 13).
{ECO:0000303|PubMed:11754007,
ECO:0000303|PubMed:15551350}.
/FTId=VSP_017607.
VAR_SEQ 78 166 Missing (in isoform 3 and isoform 12).
{ECO:0000303|PubMed:11754007,
ECO:0000303|PubMed:15551350}.
/FTId=VSP_017608.
VAR_SEQ 167 261 Missing (in isoform 8).
{ECO:0000303|PubMed:15551350}.
/FTId=VSP_017609.
VARIANT 349 349 R -> Q (in dbSNP:rs11746).
{ECO:0000269|PubMed:11754007,
ECO:0000269|PubMed:11891275,
ECO:0000269|PubMed:12202404,
ECO:0000269|PubMed:12975309,
ECO:0000269|PubMed:15489334,
ECO:0000269|Ref.5}.
/FTId=VAR_025646.
CONFLICT 265 265 S -> N (in Ref. 1; AAL23904).
{ECO:0000305}.
CONFLICT 308 308 S -> P (in Ref. 1; AAL23903).
{ECO:0000305}.
CONFLICT 317 317 L -> P (in Ref. 1; AAL27307).
{ECO:0000305}.
CONFLICT 343 343 R -> G (in Ref. 1; AAL23905).
{ECO:0000305}.
STRAND 173 178 {ECO:0000244|PDB:4HWN}.
STRAND 188 193 {ECO:0000244|PDB:4HWN}.
STRAND 206 211 {ECO:0000244|PDB:4HWN}.
STRAND 214 221 {ECO:0000244|PDB:4HWN}.
STRAND 224 229 {ECO:0000244|PDB:4HWN}.
HELIX 232 234 {ECO:0000244|PDB:4HWN}.
STRAND 236 243 {ECO:0000244|PDB:4HWN}.
STRAND 247 252 {ECO:0000244|PDB:4HWN}.
STRAND 256 258 {ECO:0000244|PDB:4HWN}.
SEQUENCE 359 AA; 38927 MW; 76821DADB121499F CRC64;
MKLGCVLMAW ALYLSLGVLW VAQMLLAASF ETLQCEGPVC TEESSCHTED DLTDAREAGF
QVKAYTFSEP FHLIVSYDWL ILQGPAKPVF EGDLLVLRCQ AWQDWPLTQV TFYRDGSALG
PPGPNREFSI TVVQKADSGH YHCSGIFQSP GPGIPETASV VAITVQELFP APILRAVPSA
EPQAGSPMTL SCQTKLPLQR SAARLLFSFY KDGRIVQSRG LSSEFQIPTA SEDHSGSYWC
EAATEDNQVW KQSPQLEIRV QGASSSAAPP TLNPAPQKSA APGTAPEEAP GPLPPPPTPS
SEDPGFSSPL GMPDPHLYHQ MGLLLKHMQD VRVLLGHLLM ELRELSGHRK PGTTKATAE


Related products :

Catalog number Product name Quantity
EIAAB14686 Fc receptor homolog expressed in B-cells,Fc receptor-like A,Fc receptor-like and mucin-like protein 1,Fc receptor-like protein,Fc receptor-related protein X,Fcrl,Fcrl1,Fcrla,Fcrlm1,FcRX,Fcrx,Freb,Mous
EIAAB14687 Fc receptor homolog expressed in B-cells,Fc receptor-like A,Fc receptor-like and mucin-like protein 1,Fc receptor-like protein,Fc receptor-related protein X,FCRL,FCRL1,FCRLA,FCRLM1,FcRX,FCRX,FREB,Homo
EIAAB14690 Fc receptor homolog expressed in B cells protein 2,Fc receptor-like and mucin-like protein 2,Fc receptor-like B,Fc receptor-like protein 2,Fc receptor-related protein Y,FCRL2,FCRLB,FCRLM2,FcRY,FCRY,FR
EIAAB14689 Fc receptor homolog expressed in B cells protein 2,Fc receptor-like and mucin-like protein 2,Fc receptor-like B,Fc receptor-like protein 2,Fc receptor-related protein Y,Fcrl2,Fcrlb,Fcrlm2,FcRY,Fcry,Fr
EIAAB33391 Homo sapiens,Human,NgR3,NGRH2,NGRL2,Nogo receptor-like 2,Nogo-66 receptor homolog 2,Nogo-66 receptor-related protein 3,Reticulon-4 receptor-like 1,RTN4RL1
EIAAB33395 Homo sapiens,Human,NgR2,NGRH1,NGRL3,Nogo receptor-like 3,Nogo-66 receptor homolog 1,Nogo-66 receptor-related protein 2,Reticulon-4 receptor-like 2,RTN4RL2
EIAAB33394 NgR2,Ngrh1,Nogo receptor-like 3,Nogo-66 receptor homolog 1,Nogo-66 receptor-related protein 2,Rat,Rattus norvegicus,Reticulon-4 receptor-like 2,Rtn4rl2
EIAAB33393 Mouse,Mus musculus,NgR2,Ngrl3,Nogo receptor-like 3,Nogo-66 receptor homolog 1,Nogo-66 receptor-related protein 2,Reticulon-4 receptor-like 2,Rtn4rl2
EIAAB33392 NgR3,Ngrh2,Nogo receptor-like 2,Nogo-66 receptor homolog 2,Nogo-66 receptor-related protein 3,Rat,Rattus norvegicus,Reticulon-4 receptor-like 1,Rtn4rl1
EIAAB33390 Mouse,Mus musculus,NgR3,Ngrl2,Nogo receptor-like 2,Nogo-66 receptor homolog 2,Nogo-66 receptor-related protein 3,Reticulon-4 receptor-like 1,Rtn4rl1
15-288-21562 Fc receptor-like protein 2 - SH2 domain-containing phosphatase anchor protein 1; Fc receptor homolog 2; FcRH2; Immunoglobulin receptor translocation-associated 4 protein Polyclonal 0.05 mg
15-288-21562 Fc receptor-like protein 2 - SH2 domain-containing phosphatase anchor protein 1; Fc receptor homolog 2; FcRH2; Immunoglobulin receptor translocation-associated 4 protein Polyclonal 0.1 mg
EIAAB25401 GPR140,GPR168,G-protein coupled receptor 140,G-protein coupled receptor 168,Homo sapiens,Human,Mas-related gene F protein,Mas-related G-protein coupled receptor member F,MRGF,MRGPRF,PSEC0142
EIAAB39868 Acetyl LDL receptor,Kiaa0149,Mouse,Mus musculus,Scarf1,Scavenger receptor class F member 1,Scavenger receptor expressed by endothelial cells 1 protein,Srec,SREC-I
EIAAB36674 AGR16,Edg5,Endothelial differentiation G-protein coupled receptor 5,G-protein coupled receptor H218,Rat,Rattus norvegicus,S1P receptor 2,S1P receptor Edg-5,S1P2,S1pr2,Sphingosine 1-phosphate receptor
EIAAB12927 EGF-like module receptor 4,EMR4,EMR4P,GPR127,G-protein coupled receptor 127,G-protein coupled receptor PGR16,Homo sapiens,Human,PGR16,Putative EGF-like module-containing mucin-like hormone receptor-li
EIAAB36673 Edg5,Endothelial differentiation G-protein coupled receptor 5,Gpcr13,Lpb2,Lysophospholipid receptor B2,Mouse,Mus musculus,S1P receptor 2,S1P receptor Edg-5,S1P2,S1pr2,Sphingosine 1-phosphate receptor
EIAAB36681 Edg8,Endothelial differentiation G-protein-coupled receptor 8,Lpb4,Lysophospholipid receptor B4,Mouse,Mus musculus,S1P receptor 5,S1P receptor Edg-8,S1P5,S1pr5,Sphingosine 1-phosphate receptor 5,Sphin
EIAAB36677 Edg3,Endothelial differentiation G-protein coupled receptor 3,Lpb3,Lysophospholipid receptor B3,Mouse,Mus musculus,S1P receptor 3,S1P receptor Edg-3,S1P3,S1pr3,Sphingosine 1-phosphate receptor 3,Sphin
EIAAB36669 Edg1,Endothelial differentiation G-protein coupled receptor 1,Lpb1,Lysophospholipid receptor B1,Mouse,Mus musculus,S1P receptor 1,S1P receptor Edg-1,S1P1,S1pr1,Sphingosine 1-phosphate receptor 1,Sphin
18-461-10745 Putative G-protein coupled receptor 44 - Chemoattractant receptor-homologous molecule expressed on Th2 cells; CD294 antigen Polyclonal 0.05 ml
18-461-10470 Putative G-protein coupled receptor 44 - Chemoattractant receptor-homologous molecule expressed on Th2 cells; CD294 antigen Polyclonal 0.05 ml
18-461-10469 Putative G-protein coupled receptor 44 - Chemoattractant receptor-homologous molecule expressed on Th2 cells; CD294 antigen Polyclonal 0.05 ml
18-461-10468 Putative G-protein coupled receptor 44 - Chemoattractant receptor-homologous molecule expressed on Th2 cells; CD294 antigen Polyclonal 0.05 ml
18-001-30071 Putative G-protein coupled receptor 44 - Chemoattractant receptor-homologous molecule expressed on Th2 cells; CD294 antigen Polyclonal 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur