Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Fibroblast growth factor 8 (FGF-8) (Androgen-induced growth factor) (AIGF) (Heparin-binding growth factor 8) (HBGF-8)

 FGF8_MOUSE              Reviewed;         268 AA.
P37237;
01-OCT-1994, integrated into UniProtKB/Swiss-Prot.
01-OCT-1994, sequence version 1.
10-MAY-2017, entry version 154.
RecName: Full=Fibroblast growth factor 8;
Short=FGF-8;
AltName: Full=Androgen-induced growth factor;
Short=AIGF;
AltName: Full=Heparin-binding growth factor 8;
Short=HBGF-8;
Flags: Precursor;
Name=Fgf8; Synonyms=Aigf;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA], AND PARTIAL PROTEIN SEQUENCE.
PubMed=1409588; DOI=10.1073/pnas.89.19.8928;
Tanaka A., Miyamoto K., Minamino N., Takeda M., Sato B., Matsuo H.,
Matsumoto K.;
"Cloning and characterization of an androgen-induced growth factor
essential for the androgen-dependent growth of mouse mammary carcinoma
cells.";
Proc. Natl. Acad. Sci. U.S.A. 89:8928-8932(1992).
[2]
NUCLEOTIDE SEQUENCE [MRNA], AND FUNCTION.
TISSUE=Mammary carcinoma;
PubMed=7884899;
Macarthur C.A., Shankar D.B., Shackleford G.M.;
"Fgf-8, activated by proviral insertion, cooperates with the Wnt-1
transgene in murine mammary tumorigenesis.";
J. Virol. 69:2501-2507(1995).
[3]
NUCLEOTIDE SEQUENCE [MRNA].
PubMed=7583127; DOI=10.1016/S0960-9822(95)00157-6;
Mahmood R., Bresnick J., Hornbruch A., Mahony C., Morton N.,
Colquhoun K., Martin P., Lumsden A., Dickson C., Mason I.;
"A role for FGF-8 in the initiation and maintenance of vertebrate limb
bud outgrowth.";
Curr. Biol. 5:797-806(1995).
-!- FUNCTION: Plays an important role in the regulation of embryonic
development, cell proliferation, cell differentiation and cell
migration. Required for normal brain, eye, ear and limb
development during embryogenesis. Required for normal development
of the gonadotropin-releasing hormone (GnRH) neuronal system.
Plays a role in neurite outgrowth in hippocampal cells (By
similarity). Cooperates with Wnt-1 in mouse mammary tumor virus-
induced murine mammary tumorigenesis (PubMed:7884899).
{ECO:0000250|UniProtKB:P55075, ECO:0000269|PubMed:7884899}.
-!- SUBUNIT: Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3
and FGFR4. Affinity between fibroblast growth factors (FGFs) and
their receptors is increased by heparan sulfate glycosaminoglycans
that function as coreceptors (By similarity). {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Comment=Additional isoforms seem to exist.;
Name=FGF-8C;
IsoId=P37237-1; Sequence=Displayed;
Name=FGF-8B;
IsoId=P37237-2; Sequence=VSP_001527;
Name=FGF-8A;
IsoId=P37237-3; Sequence=VSP_001528;
-!- TISSUE SPECIFICITY: Absent in normal mammary glands and detected
only in adult testis and ovary and in midgestational embryos.
-!- INDUCTION: By androgens.
-!- PTM: The N-terminus is blocked.
-!- SIMILARITY: Belongs to the heparin-binding growth factors family.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; D12483; BAA02051.1; -; mRNA.
EMBL; D12482; BAA02050.1; -; mRNA.
EMBL; U18673; AAA65387.1; -; mRNA.
EMBL; Z48746; CAA88637.1; -; mRNA.
CCDS; CCDS29864.1; -. [P37237-1]
CCDS; CCDS50450.1; -. [P37237-3]
CCDS; CCDS50451.1; -. [P37237-2]
PIR; A46245; A46245.
PIR; B46245; B46245.
RefSeq; NP_001159834.1; NM_001166362.1. [P37237-2]
RefSeq; NP_001159835.1; NM_001166363.1. [P37237-3]
RefSeq; NP_034335.1; NM_010205.2. [P37237-1]
UniGene; Mm.4012; -.
ProteinModelPortal; P37237; -.
SMR; P37237; -.
DIP; DIP-6030N; -.
IntAct; P37237; 1.
STRING; 10090.ENSMUSP00000026241; -.
PhosphoSitePlus; P37237; -.
PaxDb; P37237; -.
PRIDE; P37237; -.
Ensembl; ENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219. [P37237-1]
Ensembl; ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219. [P37237-3]
Ensembl; ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219. [P37237-2]
GeneID; 14179; -.
KEGG; mmu:14179; -.
UCSC; uc008hrh.2; mouse. [P37237-3]
UCSC; uc012bmo.1; mouse. [P37237-1]
CTD; 2253; -.
MGI; MGI:99604; Fgf8.
eggNOG; KOG3885; Eukaryota.
eggNOG; ENOG4111IPH; LUCA.
GeneTree; ENSGT00730000110785; -.
HOGENOM; HOG000115986; -.
HOVERGEN; HBG005659; -.
InParanoid; P37237; -.
KO; K04358; -.
OrthoDB; EOG091G0NQH; -.
PhylomeDB; P37237; -.
TreeFam; TF331233; -.
Reactome; R-MMU-109704; PI3K Cascade.
Reactome; R-MMU-1257604; PIP3 activates AKT signaling.
Reactome; R-MMU-190322; FGFR4 ligand binding and activation.
Reactome; R-MMU-190371; FGFR3b ligand binding and activation.
Reactome; R-MMU-190372; FGFR3c ligand binding and activation.
Reactome; R-MMU-190373; FGFR1c ligand binding and activation.
Reactome; R-MMU-190375; FGFR2c ligand binding and activation.
Reactome; R-MMU-5654219; Phospholipase C-mediated cascade: FGFR1.
Reactome; R-MMU-5654221; Phospholipase C-mediated cascade, FGFR2.
Reactome; R-MMU-5654227; Phospholipase C-mediated cascade, FGFR3.
Reactome; R-MMU-5654228; Phospholipase C-mediated cascade, FGFR4.
Reactome; R-MMU-5654687; Downstream signaling of activated FGFR1.
Reactome; R-MMU-5654688; SHC-mediated cascade:FGFR1.
Reactome; R-MMU-5654689; PI-3K cascade:FGFR1.
Reactome; R-MMU-5654693; FRS-mediated FGFR1 signaling.
Reactome; R-MMU-5654695; PI-3K cascade:FGFR2.
Reactome; R-MMU-5654699; SHC-mediated cascade:FGFR2.
Reactome; R-MMU-5654700; FRS-mediated FGFR2 signaling.
Reactome; R-MMU-5654704; SHC-mediated cascade:FGFR3.
Reactome; R-MMU-5654706; FRS-mediated FGFR3 signaling.
Reactome; R-MMU-5654710; PI-3K cascade:FGFR3.
Reactome; R-MMU-5654712; FRS-mediated FGFR4 signaling.
Reactome; R-MMU-5654719; SHC-mediated cascade:FGFR4.
Reactome; R-MMU-5654720; PI-3K cascade:FGFR4.
Reactome; R-MMU-5654726; Negative regulation of FGFR1 signaling.
Reactome; R-MMU-5654727; Negative regulation of FGFR2 signaling.
Reactome; R-MMU-5654732; Negative regulation of FGFR3 signaling.
Reactome; R-MMU-5654733; Negative regulation of FGFR4 signaling.
Reactome; R-MMU-5658623; FGFRL1 modulation of FGFR1 signaling.
Reactome; R-MMU-5673001; RAF/MAP kinase cascade.
Reactome; R-MMU-6811558; PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.
PRO; PR:P37237; -.
Proteomes; UP000000589; Chromosome 19.
Bgee; ENSMUSG00000025219; -.
CleanEx; MM_FGF8; -.
ExpressionAtlas; P37237; baseline and differential.
Genevisible; P37237; MM.
GO; GO:0009897; C:external side of plasma membrane; IEA:Ensembl.
GO; GO:0005615; C:extracellular space; ISO:MGI.
GO; GO:0005622; C:intracellular; IEA:GOC.
GO; GO:0042056; F:chemoattractant activity; IEA:Ensembl.
GO; GO:0008083; F:growth factor activity; ISO:MGI.
GO; GO:0005105; F:type 1 fibroblast growth factor receptor binding; ISO:MGI.
GO; GO:0005111; F:type 2 fibroblast growth factor receptor binding; ISO:MGI.
GO; GO:0035909; P:aorta morphogenesis; IGI:MGI.
GO; GO:0006915; P:apoptotic process; IMP:MGI.
GO; GO:0001974; P:blood vessel remodeling; IGI:MGI.
GO; GO:0030509; P:BMP signaling pathway; IDA:MGI.
GO; GO:0060348; P:bone development; ISO:MGI.
GO; GO:0001569; P:branching involved in blood vessel morphogenesis; IGI:MGI.
GO; GO:0060445; P:branching involved in salivary gland morphogenesis; IMP:MGI.
GO; GO:0001658; P:branching involved in ureteric bud morphogenesis; IMP:MGI.
GO; GO:0060070; P:canonical Wnt signaling pathway; IDA:MGI.
GO; GO:0045165; P:cell fate commitment; IGI:MGI.
GO; GO:0090134; P:cell migration involved in mesendoderm migration; IMP:MGI.
GO; GO:0021846; P:cell proliferation in forebrain; IMP:MGI.
GO; GO:0060128; P:corticotropin hormone secreting cell differentiation; IDA:MGI.
GO; GO:0007368; P:determination of left/right symmetry; IMP:MGI.
GO; GO:0071542; P:dopaminergic neuron differentiation; ISO:MGI.
GO; GO:0033563; P:dorsal/ventral axon guidance; IEA:Ensembl.
GO; GO:0009792; P:embryo development ending in birth or egg hatching; IMP:MGI.
GO; GO:0035050; P:embryonic heart tube development; IMP:MGI.
GO; GO:0035116; P:embryonic hindlimb morphogenesis; IGI:MGI.
GO; GO:0003198; P:epithelial to mesenchymal transition involved in endocardial cushion formation; IDA:MGI.
GO; GO:0008543; P:fibroblast growth factor receptor signaling pathway; IDA:MGI.
GO; GO:0021798; P:forebrain dorsal/ventral pattern formation; IMP:MGI.
GO; GO:0048853; P:forebrain morphogenesis; IMP:MGI.
GO; GO:0021884; P:forebrain neuron development; IEA:Ensembl.
GO; GO:0048699; P:generation of neurons; IMP:MGI.
GO; GO:0008406; P:gonad development; ISO:MGI.
GO; GO:0007507; P:heart development; IMP:MGI.
GO; GO:0001947; P:heart looping; IMP:MGI.
GO; GO:0003007; P:heart morphogenesis; IMP:MGI.
GO; GO:0042472; P:inner ear morphogenesis; IGI:MGI.
GO; GO:0001822; P:kidney development; IMP:MGI.
GO; GO:0035108; P:limb morphogenesis; IGI:MGI.
GO; GO:0030324; P:lung development; IMP:MGI.
GO; GO:0060425; P:lung morphogenesis; IMP:MGI.
GO; GO:0030539; P:male genitalia development; IDA:MGI.
GO; GO:0000165; P:MAPK cascade; IMP:MGI.
GO; GO:0008078; P:mesodermal cell migration; IMP:MGI.
GO; GO:0001656; P:metanephros development; IEA:Ensembl.
GO; GO:0030917; P:midbrain-hindbrain boundary development; IMP:MGI.
GO; GO:0008045; P:motor neuron axon guidance; IEA:Ensembl.
GO; GO:0043066; P:negative regulation of apoptotic process; IMP:MGI.
GO; GO:0055026; P:negative regulation of cardiac muscle tissue development; ISO:MGI.
GO; GO:0043524; P:negative regulation of neuron apoptotic process; IMP:MGI.
GO; GO:0001839; P:neural plate morphogenesis; IMP:MGI.
GO; GO:0060563; P:neuroepithelial cell differentiation; ISO:MGI.
GO; GO:0042476; P:odontogenesis; IEA:Ensembl.
GO; GO:0001759; P:organ induction; IGI:MGI.
GO; GO:0030916; P:otic vesicle formation; IGI:MGI.
GO; GO:0003151; P:outflow tract morphogenesis; IGI:MGI.
GO; GO:0003148; P:outflow tract septum morphogenesis; IGI:UniProtKB.
GO; GO:0021543; P:pallium development; IMP:MGI.
GO; GO:0060037; P:pharyngeal system development; IGI:MGI.
GO; GO:0051781; P:positive regulation of cell division; IEA:UniProtKB-KW.
GO; GO:0008284; P:positive regulation of cell proliferation; IDA:MGI.
GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; IGI:MGI.
GO; GO:0010628; P:positive regulation of gene expression; IDA:MGI.
GO; GO:0045840; P:positive regulation of mitotic nuclear division; IDA:MGI.
GO; GO:0046622; P:positive regulation of organ growth; IMP:MGI.
GO; GO:0042487; P:regulation of odontogenesis of dentin-containing tooth; IGI:MGI.
GO; GO:0042493; P:response to drug; IEA:Ensembl.
GO; GO:0014070; P:response to organic cyclic compound; IEA:Ensembl.
GO; GO:0006979; P:response to oxidative stress; IEA:Ensembl.
GO; GO:0023019; P:signal transduction involved in regulation of gene expression; IDA:MGI.
GO; GO:0021544; P:subpallium development; IMP:MGI.
GO; GO:0021537; P:telencephalon development; IMP:MGI.
GO; GO:0030878; P:thyroid gland development; IMP:MGI.
GO; GO:0060129; P:thyroid-stimulating hormone-secreting cell differentiation; IDA:MGI.
CDD; cd00058; FGF; 1.
InterPro; IPR028249; FGF8.
InterPro; IPR002209; Fibroblast_GF_fam.
InterPro; IPR008996; IL1/FGF.
PANTHER; PTHR11486; PTHR11486; 1.
PANTHER; PTHR11486:SF104; PTHR11486:SF104; 1.
Pfam; PF00167; FGF; 1.
SMART; SM00442; FGF; 1.
SUPFAM; SSF50353; SSF50353; 1.
PROSITE; PS00247; HBGF_FGF; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Developmental protein;
Differentiation; Direct protein sequencing; Glycoprotein;
Growth factor; Mitogen; Pyrrolidone carboxylic acid;
Reference proteome; Secreted; Signal.
SIGNAL 1 22 {ECO:0000255}.
CHAIN 23 268 Fibroblast growth factor 8.
/FTId=PRO_0000008971.
MOD_RES 23 23 Pyrrolidone carboxylic acid.
{ECO:0000255}.
CARBOHYD 60 60 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 190 190 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 24 87 Missing (in isoform FGF-8A).
{ECO:0000305}.
/FTId=VSP_001528.
VAR_SEQ 24 87 VRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNP
APNYPEEGSKEQRDSVLPKVTQR -> VTVQSSPNFTQ
(in isoform FGF-8B). {ECO:0000305}.
/FTId=VSP_001527.
SEQUENCE 268 AA; 30420 MW; 3330A9F342AD7109 CRC64;
MGSPRSALSC LLLHLLVLCL QAQVRSAAQK RGPGAGNPAD TLGQGHEDRP FGQRSRAGKN
FTNPAPNYPE EGSKEQRDSV LPKVTQRHVR EQSLVTDQLS RRLIRTYQLY SRTSGKHVQV
LANKRINAMA EDGDPFAKLI VETDTFGSRV RVRGAETGLY ICMNKKGKLI AKSNGKGKDC
VFTEIVLENN YTALQNAKYE GWYMAFTRKG RPRKGSKTRQ HQREVHFMKR LPRGHHTTEQ
SLRFEFLNYP PFTRSLRGSQ RTWAPEPR


Related products :

Catalog number Product name Quantity
E2137h ELISA kit AIGF,AIGF,Androgen-induced growth factor,FGF8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8,Homo sapiens,Human 96T
U2137h CLIA AIGF,AIGF,Androgen-induced growth factor,FGF8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8,Homo sapiens,Human 96T
E2137h ELISA AIGF,AIGF,Androgen-induced growth factor,FGF8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8,Homo sapiens,Human 96T
U2137h CLIA kit AIGF,AIGF,Androgen-induced growth factor,FGF8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8,Homo sapiens,Human 96T
U2137m CLIA kit AIGF,Aigf,Androgen-induced growth factor,Fgf8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8,Mouse,Mus musculus 96T
E2137m ELISA kit AIGF,Aigf,Androgen-induced growth factor,Fgf8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8,Mouse,Mus musculus 96T
U2137m CLIA AIGF,Aigf,Androgen-induced growth factor,Fgf8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8,Mouse,Mus musculus 96T
E2137m ELISA AIGF,Aigf,Androgen-induced growth factor,Fgf8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8,Mouse,Mus musculus 96T
E2137c ELISA kit AIGF,Androgen-induced growth factor,Canis familiaris,Canis lupus familiaris,Dog,FGF8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8 96T
E2137c ELISA AIGF,Androgen-induced growth factor,Canis familiaris,Canis lupus familiaris,Dog,FGF8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8 96T
U2137c CLIA kit AIGF,Androgen-induced growth factor,Canis familiaris,Canis lupus familiaris,Dog,FGF8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8 96T
U2137c CLIA AIGF,Androgen-induced growth factor,Canis familiaris,Canis lupus familiaris,Dog,FGF8,FGF-8,Fibroblast growth factor 8,HBGF-8,Heparin-binding growth factor 8 96T
E0034m ELISA Fgf4,FGF-4,Fgf-4,Fibroblast growth factor 4,HBGF-4,Heparin-binding growth factor 4,Kfgf,K-fibroblast growth factor,Mouse,Mus musculus 96T
E0034m ELISA kit Fgf4,FGF-4,Fgf-4,Fibroblast growth factor 4,HBGF-4,Heparin-binding growth factor 4,Kfgf,K-fibroblast growth factor,Mouse,Mus musculus 96T
U0034m CLIA Fgf4,FGF-4,Fgf-4,Fibroblast growth factor 4,HBGF-4,Heparin-binding growth factor 4,Kfgf,K-fibroblast growth factor,Mouse,Mus musculus 96T
U0636h CLIA FGF7,FGF-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Homo sapiens,Human,Keratinocyte growth factor,KGF,KGF 96T
E0636h ELISA kit FGF7,FGF-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Homo sapiens,Human,Keratinocyte growth factor,KGF,KGF 96T
E0636h ELISA FGF7,FGF-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Homo sapiens,Human,Keratinocyte growth factor,KGF,KGF 96T
E0032p ELISA kit Acidic fibroblast growth factor,aFGF,Alpha-endothelial cell growth factor,FGF1,FGF-1,HBGF-1,Heparin-binding growth factor 1,Pig,Sus scrofa 96T
U0032p CLIA Acidic fibroblast growth factor,aFGF,Alpha-endothelial cell growth factor,FGF1,FGF-1,HBGF-1,Heparin-binding growth factor 1,Pig,Sus scrofa 96T
E0032p ELISA Acidic fibroblast growth factor,aFGF,Alpha-endothelial cell growth factor,FGF1,FGF-1,HBGF-1,Heparin-binding growth factor 1,Pig,Sus scrofa 96T
E0636r ELISA Fgf7,FGF-7,Fgf-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Kgf,Rat,Rattus norvegicus 96T
E0636r ELISA kit Fgf7,FGF-7,Fgf-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Kgf,Rat,Rattus norvegicus 96T
E0636m ELISA Fgf7,FGF-7,Fgf-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Mouse,Mus musculus 96T
U0636r CLIA Fgf7,FGF-7,Fgf-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Kgf,Rat,Rattus norvegicus 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur