Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Fibroblast growth factor receptor 2 (FGFR-2) (EC 2.7.10.1) (K-sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332)

 FGFR2_HUMAN             Reviewed;         821 AA.
P21802; B4DFC2; E7EVR6; E9PCR0; P18443; Q01742; Q12922; Q14300;
Q14301; Q14302; Q14303; Q14304; Q14305; Q14672; Q14718; Q14719;
Q1KHY5; Q86YI4; Q8IXC7; Q96KL9; Q96KM0; Q96KM1; Q96KM2; Q9NZU2;
Q9NZU3; Q9UD01; Q9UD02; Q9UIH3; Q9UIH4; Q9UIH5; Q9UIH6; Q9UIH7;
Q9UIH8; Q9UM87; Q9UMC6; Q9UNS7; Q9UQH7; Q9UQH8; Q9UQH9; Q9UQI0;
01-MAY-1991, integrated into UniProtKB/Swiss-Prot.
01-MAY-1991, sequence version 1.
30-AUG-2017, entry version 228.
RecName: Full=Fibroblast growth factor receptor 2;
Short=FGFR-2;
EC=2.7.10.1 {ECO:0000269|PubMed:16844695, ECO:0000269|PubMed:18056630, ECO:0000269|PubMed:19410646, ECO:0000269|PubMed:21454610};
AltName: Full=K-sam;
Short=KGFR;
AltName: Full=Keratinocyte growth factor receptor;
AltName: CD_antigen=CD332;
Flags: Precursor;
Name=FGFR2; Synonyms=BEK, KGFR, KSAM;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Neonatal brain stem;
PubMed=1697263;
Dionne C.A., Crumley G.R., Bellot F., Kaplow J.M., Searfoss G.,
Ruta M., Burgess W.H., Jaye M., Schlessinger J.;
"Cloning and expression of two distinct high-affinity receptors cross-
reacting with acidic and basic fibroblast growth factors.";
EMBO J. 9:2685-2692(1990).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 16).
PubMed=2172978; DOI=10.1073/pnas.87.20.8180;
Houssaint E., Blanquet P.R., Champion-Arnaud P., Gesnel M.-C.,
Torriglia A., Courtois Y., Breathnach R.;
"Related fibroblast growth factor receptor genes exist in the human
genome.";
Proc. Natl. Acad. Sci. U.S.A. 87:8180-8184(1990).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 17).
PubMed=1647213; DOI=10.1016/0167-4781(91)90015-E;
Seno M., Sasada R., Watanabe T., Ishimaru K., Igarashi K.;
"Two cDNAs encoding novel human FGF receptor.";
Biochim. Biophys. Acta 1089:244-246(1991).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
TISSUE=Stomach cancer;
PubMed=2377625; DOI=10.1073/pnas.87.15.5983;
Hattori Y., Odagiri H., Nakatani H., Miyagawa K., Naito K.,
Sakamoto H., Katoh O., Yoshida T., Sugimura T., Terada M.;
"K-sam, an amplified gene in stomach cancer, is a member of the
heparin-binding growth factor receptor genes.";
Proc. Natl. Acad. Sci. U.S.A. 87:5983-5987(1990).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5; 14 AND 15).
PubMed=1313574; DOI=10.1073/pnas.89.7.2960;
Katoh M., Hattori Y., Sasaki H., Tanaka M., Sugano K., Yazaki Y.,
Sugimura T., Terada M.;
"K-sam gene encodes secreted as well as transmembrane receptor
tyrosine kinase.";
Proc. Natl. Acad. Sci. U.S.A. 89:2960-2964(1992).
[6]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), DOMAIN, AND SUBUNIT.
TISSUE=Placenta;
PubMed=1400433;
Dell K.R., Williams L.T.;
"A novel form of fibroblast growth factor receptor 2. Alternative
splicing of the third immunoglobulin-like domain confers ligand
binding specificity.";
J. Biol. Chem. 267:21225-21229(1992).
[7]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 19), SUBUNIT, DOMAIN, AND
VARIANT ARG-613.
TISSUE=Mammary gland;
PubMed=1309608; DOI=10.1073/pnas.89.1.246;
Miki T., Bottaro D.P., Fleming T.P., Smith C.L., Burgess W.H.,
Chan A.M.-L., Aaronson S.A.;
"Determination of ligand-binding specificity by alternative splicing:
two distinct growth factor receptors encoded by a single gene.";
Proc. Natl. Acad. Sci. U.S.A. 89:246-250(1992).
[8]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 19).
TISSUE=Cornea, and Mammary gland;
PubMed=7866434;
Wilson S.E., Weng J., Chwang E.L., Gollahon L., Leitch A.M.,
Shay J.W.;
"Hepatocyte growth factor (HGF), keratinocyte growth factor (KGF), and
their receptors in human breast cells and tissues: alternative
receptors.";
Cell. Mol. Biol. Res. 40:337-350(1994).
[9]
ERRATUM.
Wilson S.E., Weng J., Chwang E.L., Gollahon L., Leitch A.M.,
Shay J.W.;
Cell. Mol. Biol. Res. 40:707-707(1994).
[10]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANT CS SER-342.
TISSUE=Blood;
Steinberger D., Mueller U.;
Submitted (APR-1996) to the EMBL/GenBank/DDBJ databases.
[11]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 7; 9; 10; 11; 12 AND 13), AND
VARIANT ARG-613.
PubMed=10626794;
Ueda T., Sasaki H., Kuwahara Y., Nezu M., Shibuya T., Sakamoto H.,
Ishii H., Yanagihara K., Mafune K., Makuuchi M., Terada M.;
"Deletion of the carboxyl-terminal exons of K-sam/FGFR2 by short
homology-mediated recombination, generating preferential expression of
specific messenger RNAs.";
Cancer Res. 59:6080-6086(1999).
[12]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 5; 6; 8; 14 AND 18).
PubMed=11856867;
Ingersoll R.G., Paznekas W.A., Tran A.K., Scott A.F., Jiang G.,
Jabs E.W.;
"Fibroblast growth factor receptor 2 (FGFR2): genomic sequence and
variations.";
Cytogenet. Cell Genet. 94:121-126(2001).
[13]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3).
Lind D.L., Cox D.R.;
"Sequence and polymorphisms in fibroblast growth factor receptor 2
(FGFR2) gene in humans.";
Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases.
[14]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 23).
Jang J.;
"Identification of a novel variant of FGFR2.";
Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases.
[15]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS PRO-6 AND THR-186.
NIEHS SNPs program;
Submitted (APR-2006) to the EMBL/GenBank/DDBJ databases.
[16]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 21).
TISSUE=Cerebellum;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[17]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164054; DOI=10.1038/nature02462;
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L.,
Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K.,
Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L.,
Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P.,
Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J.,
Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J.,
Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D.,
Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L.,
Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S.,
Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L.,
Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J.,
Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M.,
Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S.,
Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M.,
Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A.,
Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T.,
Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I.,
Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T.,
Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M.,
Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W.,
Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H.,
Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L.,
Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K.,
Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T.,
Doucette-Stamm L., Beck S., Smith D.R., Rogers J.;
"The DNA sequence and comparative analysis of human chromosome 10.";
Nature 429:375-381(2004).
[18]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 20).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[19]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 314-427.
PubMed=10712195; DOI=10.1086/302831;
Glaser R.L., Jiang W., Boyadjiev S.A., Tran A.K., Zachary A.A.,
Van Maldergem L., Johnson D., Walsh S., Oldridge M., Wall S.A.,
Wilkie A.O.M., Jabs E.W.;
"Paternal origin of FGFR2 mutations in sporadic cases of Crouzon
syndrome and Pfeiffer syndrome.";
Am. J. Hum. Genet. 66:768-777(2000).
[20]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-209; 212-767 AND 771-821
(ISOFORMS 5; 14 AND 18).
PubMed=10196476; DOI=10.1016/S0378-1119(99)00047-5;
Zhang Y., Gorry M.C., Post J.C., Ehrlich G.D.;
"Genomic organization of the human fibroblast growth factor receptor 2
(FGFR2) gene and comparative analysis of the human FGFR gene family.";
Gene 230:69-79(1999).
[21]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 249-313, AND VARIANTS APRS
TRP-252 AND ARG-253.
PubMed=7668257;
Park W.-J., Theda C., Maestri N.E., Meyers G.A., Fryburg J.S.,
Dufresne C., Cohen M.M. Jr., Jabs E.W.;
"Analysis of phenotypic features and FGFR2 mutations in Apert
syndrome.";
Am. J. Hum. Genet. 57:321-328(1995).
[22]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 251-259.
PubMed=8676562;
Wada C., Ishigaki M., Toyo-oka Y., Yamabe H., Ohnuki Y., Takada F.,
Yamazaki Y., Ohtani H.;
"Nucleotide sequences at intron 6 and exon 7 junction of fibroblast
growth factor receptor 2 and rapid mutational analysis in Apert
syndrome.";
Rinsho Byori 44:435-438(1996).
[23]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 251-318.
PubMed=8673103; DOI=10.1038/ng0596-48;
Moloney D.M., Slaney S.F., Oldridge M., Wall S.A., Sahlin P.,
Stenman G., Wilkie A.O.M.;
"Exclusive paternal origin of new mutations in Apert syndrome.";
Nat. Genet. 13:48-53(1996).
[24]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 263-361, AND VARIANTS CS PRO-289;
ARG-338; SER-342; TYR-342; GLY-344 AND CYS-354.
PubMed=7581378; DOI=10.1093/hmg/4.8.1387;
Gorry M.C., Preston R.A., White G.J., Zhang Y., Singhal V.K.,
Losken H.W., Parker M.G., Nwokoro N.A., Post J.C., Ehrlich G.D.;
"Crouzon syndrome: mutations in two spliceoforms of FGFR2 and a common
point mutation shared with Jackson-Weiss syndrome.";
Hum. Mol. Genet. 4:1387-1390(1995).
[25]
FUNCTION (ISOFORM 3), SUBUNIT, AND DOMAIN.
PubMed=8961926; DOI=10.1021/bi961942c;
Gray T.E., Eisenstein M., Yayon A., Givol D.;
"Asparagine-344 is a key residue for ligand binding in keratinocyte
growth factor receptor.";
Biochemistry 35:15640-15645(1996).
[26]
INTERACTION WITH FGF1; FGF2; FGF3; FGF4; FGF6; FGF7 AND FGF9, AND
FUNCTION IN CELL PROLIFERATION.
PubMed=8663044; DOI=10.1074/jbc.271.25.15292;
Ornitz D.M., Xu J., Colvin J.S., McEwen D.G., MacArthur C.A.,
Coulier F., Gao G., Goldfarb M.;
"Receptor specificity of the fibroblast growth factor family.";
J. Biol. Chem. 271:15292-15297(1996).
[27]
INVOLVEMENT IN SCS, AND VARIANT SCS 269-VAL-VAL-270 DEL.
PubMed=9585583; DOI=10.1086/301855;
Paznekas W.A., Cunningham M.L., Howard T.D., Korf B.R., Lipson M.H.,
Grix A.W., Feingold M., Goldberg R., Borochowitz Z., Aleck K.,
Mulliken J., Yin M., Jabs E.W.;
"Genetic heterogeneity of Saethre-Chotzen syndrome, due to TWIST and
FGFR mutations.";
Am. J. Hum. Genet. 62:1370-1380(1998).
[28]
FUNCTION IN PHOSPHORYLATION OF PAK4; REGULATION OF CELL PROLIFERATION
AND APOPTOSIS, AND INTERACTION WITH GRB2 AND PAK4.
PubMed=12529371; DOI=10.1074/jbc.M205875200;
Lu Y., Pan Z.-Z., Devaux Y., Ray P.;
"p21-activated protein kinase 4 (PAK4) interacts with the keratinocyte
growth factor receptor and participates in keratinocyte growth factor-
mediated inhibition of oxidant-induced cell death.";
J. Biol. Chem. 278:10374-10380(2003).
[29]
FUNCTION IN OSTEOBLAST DIFFERENTIATION AND IN PHOSPHORYLATION OF CBL,
INTERACTION WITH CBL, UBIQUITINATION, AND CHARACTERIZATION OF VARIANT
APRS TRP-252.
PubMed=15190072; DOI=10.1074/jbc.M402469200;
Kaabeche K., Lemonnier J., Le Mee S., Caverzasio J., Marie P.J.;
"Cbl-mediated degradation of Lyn and Fyn induced by constitutive
fibroblast growth factor receptor-2 activation supports osteoblast
differentiation.";
J. Biol. Chem. 279:36259-36267(2004).
[30]
FUNCTION IN CELL PROLIFERATION AND ACTIVATION OF SIGNALING PATHWAYS,
MUTAGENESIS OF TYR-769, PHOSPHORYLATION AT TYR-769, AND INTERACTION
WITH PLCG1.
PubMed=15629145; DOI=10.1016/j.bbrc.2004.12.031;
Ceridono M., Belleudi F., Ceccarelli S., Torrisi M.R.;
"Tyrosine 769 of the keratinocyte growth factor receptor is required
for receptor signaling but not endocytosis.";
Biochem. Biophys. Res. Commun. 327:523-532(2005).
[31]
INTERACTION WITH FGF1; FGF7; FGF8; FGF9; FGF10; FGF19; FGF21; FGF22
AND FGF23, AND FUNCTION IN STIMULATION OF CELL PROLIFERATION.
PubMed=16597617; DOI=10.1074/jbc.M601252200;
Zhang X., Ibrahimi O.A., Olsen S.K., Umemori H., Mohammadi M.,
Ornitz D.M.;
"Receptor specificity of the fibroblast growth factor family. The
complete mammalian FGF family.";
J. Biol. Chem. 281:15694-15700(2006).
[32]
FUNCTION IN PHOSPHORYLATION OF PLCG1 (ISOFORM 1), CATALYTIC ACTIVITY,
AUTOPHOSPHORYLATION, GLYCOSYLATION, INTERACTION WITH PLCG1,
SUBCELLULAR LOCATION, MUTAGENESIS OF ASN-265 AND 656-TYR-TYR-657,
UBIQUITINATION, AND CHARACTERIZATION OF VARIANT PS PHE-278.
PubMed=16844695; DOI=10.1074/jbc.M600448200;
Hatch N.E., Hudson M., Seto M.L., Cunningham M.L., Bothwell M.;
"Intracellular retention, degradation, and signaling of glycosylation-
deficient FGFR2 and craniosynostosis syndrome-associated FGFR2C278F.";
J. Biol. Chem. 281:27292-27305(2006).
[33]
INTERACTION WITH FGF19; FGF21 AND KLB, AND FUNCTION IN PHOSPHORYLATION
OF FRS2 AND ACTIVATION OF MAP KINASES.
PubMed=17623664; DOI=10.1074/jbc.M704165200;
Kurosu H., Choi M., Ogawa Y., Dickson A.S., Goetz R.,
Eliseenkova A.V., Mohammadi M., Rosenblatt K.P., Kliewer S.A.,
Kuro-o M.;
"Tissue-specific expression of betaKlotho and fibroblast growth factor
(FGF) receptor isoforms determines metabolic activity of FGF19 and
FGF21.";
J. Biol. Chem. 282:26687-26695(2007).
[34]
FUNCTION IN STAT1 PHOSPHORYLATION, GLYCOSYLATION, SUBCELLULAR
LOCATION, AND PHOSPHORYLATION.
PubMed=17311277; DOI=10.1002/jcp.21014;
Citores L., Bai L., Sorensen V., Olsnes S.;
"Fibroblast growth factor receptor-induced phosphorylation of STAT1 at
the Golgi apparatus without translocation to the nucleus.";
J. Cell. Physiol. 212:148-156(2007).
[35]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=18374639; DOI=10.1016/j.bone.2008.02.009;
Dufour C., Guenou H., Kaabeche K., Bouvard D., Sanjay A., Marie P.J.;
"FGFR2-Cbl interaction in lipid rafts triggers attenuation of PI3K/Akt
signaling and osteoblast survival.";
Bone 42:1032-1039(2008).
[36]
FUNCTION AS FGF7 RECEPTOR AND IN PHOSPHORYLATION OF PLCG1 AND FRS2,
CATALYTIC ACTIVITY, PHOSPHORYLATION AT TYR-466; TYR-586; TYR-588;
TYR-656 AND TYR-657, AND IDENTIFICATION BY MASS SPECTROMETRY.
PubMed=19410646; DOI=10.1016/j.cellsig.2009.04.004;
Luo Y., Yang C., Jin C., Xie R., Wang F., McKeehan W.L.;
"Novel phosphotyrosine targets of FGFR2IIIb signaling.";
Cell. Signal. 21:1370-1378(2009).
[37]
FUNCTION IN FIBROBLAST PROLIFERATION; ACTIVATION OF MAP KINASES AND
PHOSPHORYLATION OF PLCG1 AND FRS2, INTERACTION WITH PLCG1 AND FRS2,
SUBCELLULAR LOCATION, AND MUTAGENESIS OF TYR-769.
PubMed=19103595; DOI=10.1074/jbc.M803998200;
Cha J.Y., Maddileti S., Mitin N., Harden T.K., Der C.J.;
"Aberrant receptor internalization and enhanced FRS2-dependent
signaling contribute to the transforming activity of the fibroblast
growth factor receptor 2 IIIb C3 isoform.";
J. Biol. Chem. 284:6227-6240(2009).
[38]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19369195; DOI=10.1074/mcp.M800588-MCP200;
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,
Mann M., Daub H.;
"Large-scale proteomics analysis of the human kinome.";
Mol. Cell. Proteomics 8:1751-1764(2009).
[39]
FUNCTION, AND UBIQUITINATION.
PubMed=21596750; DOI=10.1074/jbc.M110.197525;
Severe N., Miraoui H., Marie P.J.;
"The Casitas B lineage lymphoma (Cbl) mutant G306E enhances osteogenic
differentiation in human mesenchymal stromal cells in part by
decreased Cbl-mediated platelet-derived growth factor receptor alpha
and fibroblast growth factor receptor 2 ubiquitination.";
J. Biol. Chem. 286:24443-24450(2011).
[40]
REVIEW ON LIGAND SPECIFICITY, ALTERNATIVE SPLICING, AND SIGNALING.
PubMed=15863030; DOI=10.1016/j.cytogfr.2005.01.001;
Eswarakumar V.P., Lax I., Schlessinger J.;
"Cellular signaling by fibroblast growth factor receptors.";
Cytokine Growth Factor Rev. 16:139-149(2005).
[41]
REVIEW ON LIGAND SPECIFICITY, ALTERNATIVE SPLICING, SIGNALING, AND
ROLE IN DISEASE.
PubMed=19387476; DOI=10.1038/jid.2009.97;
Katoh M.;
"FGFR2 abnormalities underlie a spectrum of bone, skin, and cancer
pathologies.";
J. Invest. Dermatol. 129:1861-1867(2009).
[42]
REVIEW ON FUNCTION IN FGF SIGNALING.
PubMed=20094046; DOI=10.1038/nrc2780;
Turner N., Grose R.;
"Fibroblast growth factor signalling: from development to cancer.";
Nat. Rev. Cancer 10:116-129(2010).
[43]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-780, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[44]
X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 147-366 IN COMPLEX WITH FGF2.
PubMed=10830168; DOI=10.1016/S0092-8674(00)80851-X;
Plotnikov A.N., Hubbard S.R., Schlessinger J., Mohammadi M.;
"Crystal structures of two FGF-FGFR complexes reveal the determinants
of ligand-receptor specificity.";
Cell 101:413-424(2000).
[45]
X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 148-366 IN COMPLEX WITH FGF1
AND HEPARIN, AND INTERACTION WITH FGF1 AND HEPARIN.
PubMed=11069186; DOI=10.1038/35039551;
Pellegrini L., Burke D.F., von Delft F., Mulloy B., Blundell T.L.;
"Crystal structure of fibroblast growth factor receptor ectodomain
bound to ligand and heparin.";
Nature 407:1029-1034(2000).
[46]
X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 147-362 IN COMPLEX WITH FGF1.
PubMed=10618369; DOI=10.1073/pnas.97.1.49;
Stauber D.J., DiGabriele A.D., Hendrickson W.A.;
"Structural interactions of fibroblast growth factor receptor with its
ligands.";
Proc. Natl. Acad. Sci. U.S.A. 97:49-54(2000).
[47]
X-RAY CRYSTALLOGRAPHY (2.7 ANGSTROMS) OF 147-366 OF VARIANTS APRS
TRP-252 AND ARG-253 IN COMPLEX WITH FGF2.
PubMed=11390973; DOI=10.1073/pnas.121183798;
Ibrahimi O.A., Eliseenkova A.V., Plotnikov A.N., Yu K., Ornitz D.M.,
Mohammadi M.;
"Structural basis for fibroblast growth factor receptor 2 activation
in Apert syndrome.";
Proc. Natl. Acad. Sci. U.S.A. 98:7182-7187(2001).
[48]
X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 140-371 IN COMPLEX WITH
FGF10.
PubMed=12591959; DOI=10.1073/pnas.0436500100;
Yeh B.K., Igarashi M., Eliseenkova A.V., Plotnikov A.N., Sher I.,
Ron D., Aaronson S.A., Mohammadi M.;
"Structural basis by which alternative splicing confers specificity in
fibroblast growth factor receptors.";
Proc. Natl. Acad. Sci. U.S.A. 100:2266-2271(2003).
[49]
X-RAY CRYSTALLOGRAPHY (2.28 ANGSTROMS) OF 149-368 IN COMPLEX WITH
FGF8, FUNCTION AS FGF8 RECEPTOR, INTERACTION WITH FGF8, AND DISULFIDE
BONDS.
PubMed=16384934; DOI=10.1101/gad.1365406;
Olsen S.K., Li J.Y.H., Bromleigh C., Eliseenkova A.V., Ibrahimi O.A.,
Lao Z., Zhang F., Linhardt R.J., Joyner A.L., Mohammadi M.;
"Structural basis by which alternative splicing modulates the
organizer activity of FGF8 in the brain.";
Genes Dev. 20:185-198(2006).
[50]
X-RAY CRYSTALLOGRAPHY (1.80 ANGSTROMS) OF 458-778 IN COMPLEX WITH ATP
ANALOG; PEPTIDE SUBSTRATE AND MAGNESIUM, ENZYME REGULATION,
PHOSPHORYLATION AT TYR-586; TYR-656 AND TYR-657, MUTAGENESIS OF
ASN-549 AND GLU-565, CHARACTERIZATION OF VARIANT FSPC GLU-526,
CHARACTERIZATION OF VARIANT CS HIS-549, CHARACTERIZATION OF VARIANTS
PS GLY-565 AND ARG-641, AND CHARACTERIZATION OF VARIANT
CRANIOSYNOSTOSIS ASN-659.
PubMed=17803937; DOI=10.1016/j.molcel.2007.06.028;
Chen H., Ma J., Li W., Eliseenkova A.V., Xu C., Neubert T.A.,
Miller W.T., Mohammadi M.;
"A molecular brake in the kinase hinge region regulates the activity
of receptor tyrosine kinases.";
Mol. Cell 27:717-730(2007).
[51]
X-RAY CRYSTALLOGRAPHY (1.80 ANGSTROMS) OF 458-766 OF VARIANT LADDS
THR-628 IN COMPLEX WITH ATP ANALOG, CATALYTIC ACTIVITY, SUBUNIT, AND
AUTOPHOSPHORYLATION.
PubMed=18056630; DOI=10.1073/pnas.0709905104;
Lew E.D., Bae J.H., Rohmann E., Wollnik B., Schlessinger J.;
"Structural basis for reduced FGFR2 activity in LADD syndrome:
Implications for FGFR autoinhibition and activation.";
Proc. Natl. Acad. Sci. U.S.A. 104:19802-19807(2007).
[52]
X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 458-778 IN COMPLEX WITH ATP,
ACTIVE SITE, IDENTIFICATION BY MASS SPECTROMETRY, AUTOPHOSPHORYLATION,
AND PHOSPHORYLATION AT TYR-466; TYR-586; TYR-588; TYR-656; TYR-657 AND
TYR-769.
PubMed=19060208; DOI=10.1073/pnas.0807752105;
Chen H., Xu C.F., Ma J., Eliseenkova A.V., Li W., Pollock P.M.,
Pitteloud N., Miller W.T., Neubert T.A., Mohammadi M.;
"A crystallographic snapshot of tyrosine trans-phosphorylation in
action.";
Proc. Natl. Acad. Sci. U.S.A. 105:19660-19665(2008).
[53]
X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 458-768 IN COMPLEX WITH
INHIBITOR, CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION, AND ENZYME
REGULATION.
PubMed=21454610; DOI=10.1074/jbc.M110.213736;
Eathiraj S., Palma R., Hirschi M., Volckova E., Nakuci E., Castro J.,
Chen C.R., Chan T.C., France D.S., Ashwell M.A.;
"A novel mode of protein kinase inhibition exploiting hydrophobic
motifs of autoinhibited kinases: discovery of ATP-independent
inhibitors of fibroblast growth factor receptor.";
J. Biol. Chem. 286:20677-20687(2011).
[54]
VARIANTS CS HIS-340; ARG-342; SER-342; TYR-342 AND CYS-354.
PubMed=7987400; DOI=10.1038/ng0994-98;
Reardon W., Winter R.M., Rutland P., Pulleyn L.J., Jones B.M.,
Malcolm S.;
"Mutations in the fibroblast growth factor receptor 2 gene cause
Crouzon syndrome.";
Nat. Genet. 8:98-103(1994).
[55]
VARIANTS CS CYS-328 AND CYS-347, AND VARIANT JWS GLY-344.
PubMed=7874170; DOI=10.1038/ng1194-275;
Jabs E.W., Li X., Scott A.F., Meyers G.A., Chen W., Eccles M., Mao J.,
Charnas L.R., Jackson C.E., Jaye M.;
"Jackson-Weiss and Crouzon syndromes are allelic with mutations in
fibroblast growth factor receptor 2.";
Nat. Genet. 8:275-279(1994).
[56]
VARIANTS CS.
PubMed=7655462; DOI=10.1093/hmg/4.6.1077;
Oldridge M., Wilkie A.O.M., Slaney S.F., Poole M.D., Pulleyn L.J.,
Rutland P., Hockley A.D., Wake M.J.C., Goldin J.H., Winter R.M.,
Reardon W., Malcolm S.;
"Mutations in the third immunoglobulin domain of the fibroblast growth
factor receptor-2 gene in Crouzon syndrome.";
Hum. Mol. Genet. 4:1077-1082(1995).
[57]
VARIANTS CS GLY-290; TRP-342 AND CYS-354, AND VARIANT JWS ARG-342.
PubMed=8528214; DOI=10.1093/hmg/4.7.1229;
Park W.-J., Meyers G.A., Li X., Theda C., Day D., Orlow S.J.,
Jones M.C., Jabs E.W.;
"Novel FGFR2 mutations in Crouzon and Jackson-Weiss syndromes show
allelic heterogeneity and phenotypic variability.";
Hum. Mol. Genet. 4:1229-1233(1995).
[58]
VARIANT PS ALA-321.
PubMed=7719333; DOI=10.1038/ng0295-108;
Lajeunie E., Wei M.H., Bonaventure J., Munnich A., le Merrer M.,
Renier D.;
"FGFR2 mutations in Pfeiffer syndrome.";
Nat. Genet. 9:108-108(1995).
[59]
VARIANTS APRS TRP-252 AND ARG-253.
PubMed=7719344; DOI=10.1038/ng0295-165;
Wilkie A.O.M., Slaney S.F., Oldridge M., Poole M.D., Ashworth G.J.,
Hockley A.D., Hayward R.D., David D.J., Pulleyn L.J., Rutland P.,
Malcolm S., Winter R.M., Reardon W.;
"Apert syndrome results from localized mutations of FGFR2 and is
allelic with Crouzon syndrome.";
Nat. Genet. 9:165-172(1995).
[60]
VARIANTS PS PRO-341; ARG-342 AND TYR-342.
PubMed=7719345; DOI=10.1038/ng0295-173;
Rutland P., Pulleyn L.J., Reardon W., Baraister M., Hayward R.,
Jones B.M., Malcolm S., Winter R.M., Oldridge M., Slaney S.F.,
Poole M.D., Wilkie A.O.M.;
"Identical mutations in the FGFR2 gene cause both Pfeiffer and Crouzon
syndrome phenotypes.";
Nat. Genet. 9:173-176(1995).
[61]
VARIANTS CS GLY-268 INS; PHE-342 AND TYR-342, VARIANTS PS PHE-278;
ARG-342; SER-342; PRO-344 AND PHE-359, AND VARIANT JWS PRO-289.
PubMed=8644708;
Meyers G.A., Day D., Goldberg R., Daentl D.L., Przylepa K.A.,
Abrams L.J., Graham J.M. Jr., Feingold M., Moeschler J.B.,
Rawnsley E., Scott A.F., Jabs E.W.;
"FGFR2 exon IIIa and IIIc mutations in Crouzon, Jackson-Weiss, and
Pfeiffer syndromes: evidence for missense changes, insertions, and a
deletion due to alternative RNA splicing.";
Am. J. Hum. Genet. 58:491-498(1996).
[62]
VARIANTS CS CYS-105; GLU-338; CYS-351 AND ARG-384.
PubMed=8946174;
Pulleyn L.J., Reardon W., Wilkes D., Rutland P., Jones B.M.,
Hayward R., Hall C.M., Brueton L., Chun N., Lammer E., Malcolm S.,
Winter R.M.;
"Spectrum of craniosynostosis phenotypes associated with novel
mutations at the fibroblast growth factor receptor 2 locus.";
Eur. J. Hum. Genet. 4:283-291(1996).
[63]
VARIANTS CS ILE-331; ASN-ALA-337 INS AND 356-TRP--THR-358 DEL.
PubMed=8956050;
DOI=10.1002/(SICI)1098-1004(1996)8:4<386::AID-HUMU18>3.3.CO;2-A;
Steinberger D., Mulliken J.B., Mueller U.;
"Crouzon syndrome: previously unrecognized deletion, duplication, and
point mutation within FGFR2 gene.";
Hum. Mutat. 8:386-390(1996).
[64]
VARIANTS BSTVS CYS-372 AND CYS-375.
PubMed=8696350; DOI=10.1038/ng0896-492;
Przylepa K.A., Paznekas W.A., Zhang M., Golabi M., Bias W.,
Bamshad M.J., Carey J.C., Hall B.D., Stevenson R., Orlow S.J.,
Cohen M.M. Jr., Jabs E.W.;
"Fibroblast growth factor receptor 2 mutations in Beare-Stevenson
cutis gyrata syndrome.";
Nat. Genet. 13:492-494(1996).
[65]
VARIANT PS CYS-290.
PubMed=9150725; DOI=10.1007/s004390050413;
Tartaglia M., Valeri S., Velardi F., di Rocco C., Battaglia P.A.;
"Trp290Cys mutation in exon IIIa of the fibroblast growth factor
receptor 2 (FGFR2) gene is associated with Pfeiffer syndrome.";
Hum. Genet. 99:602-606(1997).
[66]
VARIANT JWS SER-342.
PubMed=9385368; DOI=10.1007/s004390050584;
Tartaglia M., Di Rocco C., Lajeunie E., Valeri S., Velardi F.,
Battaglia P.A.;
"Jackson-Weiss syndrome: identification of two novel FGFR2 missense
mutations shared with Crouzon and Pfeiffer craniosynostotic
disorders.";
Hum. Genet. 101:47-50(1997).
[67]
VARIANT CS LEU-252, VARIANT APRS PHE-252, AND VARIANT PS
252-PHE-SER-253.
PubMed=9002682; DOI=10.1093/hmg/6.1.137;
Oldridge M., Lunt P.W., Zackai E.H., McDonald-Mcginn D.M., Muenke M.,
Moloney D.M., Twigg S.R.F., Heath J.K., Howard T.D., Hoganson G.,
Gagnon D.M., Jabs E.W., Wilkie A.O.M.;
"Genotype-phenotype correlation for nucleotide substitutions in the
IgII-IgIII linker of FGFR2.";
Hum. Mol. Genet. 6:137-143(1997).
[68]
VARIANT CS GLU-292.
PubMed=9152842; DOI=10.1136/jmg.34.5.420;
Steinberger D., Collmann H., Schmalenberger B., Mueller U.;
"A novel mutation (a886g) in exon 5 of FGFR2 in members of a family
with Crouzon phenotype and plagiocephaly.";
J. Med. Genet. 34:420-422(1997).
[69]
VARIANTS CS PHE-278; PRO-337; ARG-338; ARG-342; PHE-342 AND TYR-342,
VARIANTS APRS TRP-252 AND ARG-253, AND VARIANT JWS PHE-278.
PubMed=9677057;
DOI=10.1002/(SICI)1096-8628(19980707)78:3<237::AID-AJMG5>3.3.CO;2-5;
Passos-Bueno M.R., Sertie A.L., Richieri-Costa A., Alonso L.G.,
Zatz M., Alonso N., Brunoni D., Ribeiro S.F.M.;
"Description of a new mutation and characterization of FGFR1, FGFR2,
and FGFR3 mutations among Brazilian patients with syndromic
craniosynostoses.";
Am. J. Med. Genet. 78:237-241(1998).
[70]
VARIANTS CS VAL-276 AND CYS-301, AND VARIANT CRANIOSYNOSTOSIS SER-314.
PubMed=9521581; DOI=10.1007/s004390050668;
Steinberger D., Vriend G., Mulliken J.B., Mueller U.;
"The mutations in FGFR2-associated craniosynostoses are clustered in
five structural elements of immunoglobulin-like domain III of the
receptor.";
Hum. Genet. 102:145-150(1998).
[71]
VARIANTS APRS TRP-252 AND ARG-253.
PubMed=9452027;
Tsai F.-J., Hwu W.-L., Lin S.-P., Chang J.-G., Wang T.-R., Tsai C.-H.;
"Two common mutations 934C to G and 937C to G of fibroblast growth
factor receptor 2 (FGFR2) gene in Chinese patients with Apert
syndrome.";
Hum. Mutat. Suppl. 1:S18-S19(1998).
[72]
VARIANT PS CYS-351.
PubMed=9693549;
Mathijssen I.M., Vaandrager J.M., Hoogeboom A.J.,
Hesseling-Janssen A.L.W., van den Ouweland A.M.W.;
"Pfeiffer's syndrome resulting from an S351C mutation in the
fibroblast growth factor receptor-2 gene.";
J. Craniofac. Surg. 9:207-209(1998).
[73]
VARIANT PS TRP-252.
PubMed=9719378; DOI=10.1136/jmg.35.8.677;
Passos-Bueno M.R., Richieri-Costa A., Sertie A.L., Kneppers A.;
"Presence of the Apert canonical S252W FGFR2 mutation in a patient
without severe syndactyly.";
J. Med. Genet. 35:677-679(1998).
[74]
VARIANT CS SER-362.
PubMed=10574673; DOI=10.1597/1545-1569(1999)036<0533:ANFGMI>2.3.CO;2;
Everett E.T., Britto D.A., Ward R.E., Hartsfield J.K. Jr.;
"A novel FGFR2 gene mutation in Crouzon syndrome associated with
apparent nonpenetrance.";
Cleft Palate Craniofac. J. 36:533-541(1999).
[75]
VARIANTS PS CYS-340 AND GLY-342.
PubMed=10394936; DOI=10.1007/s004390050979;
Cornejo-Roldan L.R., Roessler E., Muenke M.;
"Analysis of the mutational spectrum of the FGFR2 gene in Pfeiffer
syndrome.";
Hum. Genet. 104:425-431(1999).
[76]
VARIANT PS ASP-273 DEL.
PubMed=10945669; DOI=10.1034/j.1399-0004.2000.580116.x;
Priolo M., Lerone M., Baffico M., Baldi M., Ravazzolo R., Cama A.,
Capra V., Silengo M.;
"Pfeiffer syndrome type 2 associated with a single amino acid deletion
in the FGFR2 gene.";
Clin. Genet. 58:81-83(2000).
[77]
VARIANTS CS/PS ARG-342 AND TYR-342, VARIANTS CS LEU-263; VAL-276;
PHE-278; TYR-278; SER-288; PRO-289; PRO-341; TRP-342; CYS-354; TYR-354
AND PHE-359, AND VARIANT PS SER-342.
PubMed=11173845;
Kress W., Collmann H., Buesse M., Halliger-Keller B., Mueller C.R.;
"Clustering of FGFR2 gene mutations in patients with Pfeiffer and
Crouzon syndromes (FGFR2-associated craniosynostoses).";
Cytogenet. Cell Genet. 91:134-137(2000).
[78]
VARIANT SER-315.
PubMed=10951518; DOI=10.1038/sj.ejhg.5200499;
Johnson D., Wall S.A., Mann S., Wilkie A.O.M.;
"A novel mutation, Ala315Ser, in FGFR2: a gene-environment interaction
leading to craniosynostosis?";
Eur. J. Hum. Genet. 8:571-577(2000).
[79]
VARIANTS ABS2 ARG-342; SER-342 AND CYS-351.
PubMed=10633130; DOI=10.1136/jmg.37.1.26;
Reardon W., Smith A., Honour J.W., Hindmarsh P., Das D., Rumsby G.,
Nelson I., Malcolm S., Ades L., Sillence D., Kumar D.,
DeLozier-Blanchet C., McKee S., Kelly T., McKeehan W.L., Baraitser M.,
Winter R.M.;
"Evidence for digenic inheritance in some cases of Antley-Bixler
syndrome?";
J. Med. Genet. 37:26-32(2000).
[80]
VARIANTS CS CYS-281; PRO-289; ARG-342 AND TYR-342.
PubMed=11380921; DOI=10.1046/j.1442-200x.2001.01392.x;
Tsai F.-J., Yang C.-F., Wu J.-Y., Tsai C.-H., Lee C.-C.;
"Mutation analysis of Crouzon syndrome and identification of one novel
mutation in Taiwanese patients.";
Pediatr. Int. 43:263-266(2001).
[81]
VARIANTS CS CYS-105; PRO-267; VAL-276; CYS-281; PRO-289; ARG-338;
HIS-340; PHE-342; TRP-342; CYS-347; CYS-354; HIS-549 AND GLY-678,
VARIANTS PS PHE-172; 252-PHE-SER-253; CYS-290; CYS-340; PRO-341;
ARG-342; SER-342; CYS-375; GLY-565; ARG-641 AND GLU-663, VARIANTS APRS
TRP-252 AND ARG-253, VARIANTS CS/PS PHE-278 AND TYR-342, VARIANT
CRANIOSYNOSTOSIS ASN-659, AND VARIANTS THR-186 AND SER-315.
PubMed=11781872; DOI=10.1086/338758;
Kan S.-H., Elanko N., Johnson D., Cornejo-Roldan L.R., Cook J.,
Reich E.W., Tomkins S., Verloes A., Twigg S.R.F., Rannan-Eliya S.,
McDonald-McGinn D.M., Zackai E.H., Wall S.A., Muenke M.,
Wilkie A.O.M.;
"Genomic screening of fibroblast growth-factor receptor 2 reveals a
wide spectrum of mutations in patients with syndromic
craniosynostosis.";
Am. J. Hum. Genet. 70:472-486(2002).
[82]
VARIANT BSTVS CYS-375.
PubMed=12000365; DOI=10.1034/j.1399-0004.2002.610309.x;
Wang T.-J., Huang C.-B., Tsai F.-J., Wu J.-Y., Lai R.-B., Hsiao M.;
"Mutation in the FGFR2 gene in a Taiwanese patient with Beare-
Stevenson cutis gyrata syndrome.";
Clin. Genet. 61:218-221(2002).
[83]
VARIANT FSPC GLU-526.
PubMed=16061565; DOI=10.1136/jmg.2004.027888;
McGillivray G., Savarirayan R., Cox T.C., Stojkoski C., McNeil R.,
Bankier A., Bateman J.F., Roscioli T., Gardner R.J.M., Lamande S.R.;
"Familial scaphocephaly syndrome caused by a novel mutation in the
FGFR2 tyrosine kinase domain.";
J. Med. Genet. 42:656-662(2005).
[84]
VARIANTS LADDS THR-628; THR-648 AND 649-ARG-ASP-650 DELINS SER.
PubMed=16501574; DOI=10.1038/ng1757;
Rohmann E., Brunner H.G., Kayserili H., Uyguner O., Nuernberg G.,
Lew E.D., Dobbie A., Eswarakumar V.P., Uzumcu A., Ulubil-Emeroglu M.,
Leroy J.G., Li Y., Becker C., Lehnerdt K., Cremers C.W.R.J.,
Yueksel-Apak M., Nuernberg P., Kubisch C., Schlessinger J.,
van Bokhoven H., Wollnik B.;
"Mutations in different components of FGF signaling in LADD
syndrome.";
Nat. Genet. 38:414-417(2006).
[85]
VARIANT [LARGE SCALE ANALYSIS] CYS-203.
PubMed=16959974; DOI=10.1126/science.1133427;
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
Vogelstein B., Kinzler K.W., Velculescu V.E.;
"The consensus coding sequences of human breast and colorectal
cancers.";
Science 314:268-274(2006).
[86]
VARIANTS [LARGE SCALE ANALYSIS] LEU-57; THR-186; CYS-203; VAL-272;
ASN-283; CYS-290 AND THR-612.
PubMed=17344846; DOI=10.1038/nature05610;
Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C.,
Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S.,
O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S.,
Bhamra G., Buck G., Choudhury B., Clements J., Cole J., Dicks E.,
Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J.,
Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K.,
Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T.,
West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P.,
Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E.,
DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E.,
Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T.,
Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.;
"Patterns of somatic mutation in human cancer genomes.";
Nature 446:153-158(2007).
[87]
VARIANTS BBDS ASP-381 AND ARG-391, AND CHARACTERIZATION OF VARIANT
BBDS ARG-391.
PubMed=22387015; DOI=10.1016/j.ajhg.2012.02.005;
Merrill A.E., Sarukhanov A., Krejci P., Idoni B., Camacho N.,
Estrada K.D., Lyons K.M., Deixler H., Robinson H., Chitayat D.,
Curry C.J., Lachman R.S., Wilcox W.R., Krakow D.;
"Bent bone dysplasia-FGFR2 type, a distinct skeletal disorder, has
deficient canonical FGF signaling.";
Am. J. Hum. Genet. 90:550-557(2012).
[88]
VARIANT LEU-57.
PubMed=26429889; DOI=10.1136/jmedgenet-2015-103336;
Perles Z., Moon S., Ta-Shma A., Yaacov B., Francescatto L.,
Edvardson S., Rein A.J., Elpeleg O., Katsanis N.;
"A human laterality disorder caused by a homozygous deleterious
mutation in MMP21.";
J. Med. Genet. 52:840-847(2015).
-!- FUNCTION: Tyrosine-protein kinase that acts as cell-surface
receptor for fibroblast growth factors and plays an essential role
in the regulation of cell proliferation, differentiation,
migration and apoptosis, and in the regulation of embryonic
development. Required for normal embryonic patterning, trophoblast
function, limb bud development, lung morphogenesis, osteogenesis
and skin development. Plays an essential role in the regulation of
osteoblast differentiation, proliferation and apoptosis, and is
required for normal skeleton development. Promotes cell
proliferation in keratinocytes and immature osteoblasts, but
promotes apoptosis in differentiated osteoblasts. Phosphorylates
PLCG1, FRS2 and PAK4. Ligand binding leads to the activation of
several signaling cascades. Activation of PLCG1 leads to the
production of the cellular signaling molecules diacylglycerol and
inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers
recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates
activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase
signaling pathway, as well as of the AKT1 signaling pathway. FGFR2
signaling is down-regulated by ubiquitination, internalization and
degradation. Mutations that lead to constitutive kinase activation
or impair normal FGFR2 maturation, internalization and degradation
lead to aberrant signaling. Over-expressed FGFR2 promotes
activation of STAT1. {ECO:0000269|PubMed:12529371,
ECO:0000269|PubMed:15190072, ECO:0000269|PubMed:15629145,
ECO:0000269|PubMed:16384934, ECO:0000269|PubMed:16597617,
ECO:0000269|PubMed:17311277, ECO:0000269|PubMed:17623664,
ECO:0000269|PubMed:18374639, ECO:0000269|PubMed:19103595,
ECO:0000269|PubMed:19387476, ECO:0000269|PubMed:19410646,
ECO:0000269|PubMed:21596750, ECO:0000269|PubMed:8663044}.
-!- CATALYTIC ACTIVITY: ATP + a [protein]-L-tyrosine = ADP + a
[protein]-L-tyrosine phosphate. {ECO:0000255|PROSITE-
ProRule:PRU10028, ECO:0000269|PubMed:16844695,
ECO:0000269|PubMed:18056630, ECO:0000269|PubMed:19410646,
ECO:0000269|PubMed:21454610}.
-!- ENZYME REGULATION: Present in an inactive conformation in the
absence of bound ligand. Ligand binding leads to dimerization and
activation by autophosphorylation on tyrosine residues. Inhibited
by ARQ 523 and ARQ 069; these compounds maintain the kinase in an
inactive conformation and inhibit autophosphorylation.
{ECO:0000269|PubMed:17803937, ECO:0000269|PubMed:21454610}.
-!- SUBUNIT: Monomer. Homodimer after ligand binding. Interacts
predominantly with FGF1 and FGF2, but can also interact with FGF3,
FGF4, FGF6, FGF7, FGF8, FGF9, FGF10, FGF17, FGF18 and FGF22 (in
vitro). Ligand specificity is determined by tissue-specific
expression of isoforms, and differences in the third Ig-like
domain are crucial for ligand specificity. Isoform 1 has high
affinity for FGF1 and FGF2, but low affinity for FGF7. Isoform 3
has high affinity for FGF1 and FGF7, and has much higher affinity
for FGF7 than isoform 1 (in vitro). Affinity for fibroblast growth
factors (FGFs) is increased by heparan sulfate glycosaminoglycans
that function as coreceptors. Likewise, KLB increases the affinity
for FGF19 and FGF21. Interacts with PLCG1, GRB2 and PAK4.
Interacts with FLRT2 (By similarity).
{ECO:0000250|UniProtKB:P21803, ECO:0000269|PubMed:10618369,
ECO:0000269|PubMed:10830168, ECO:0000269|PubMed:11069186,
ECO:0000269|PubMed:11390973, ECO:0000269|PubMed:12529371,
ECO:0000269|PubMed:12591959, ECO:0000269|PubMed:1309608,
ECO:0000269|PubMed:1400433, ECO:0000269|PubMed:15190072,
ECO:0000269|PubMed:15629145, ECO:0000269|PubMed:16384934,
ECO:0000269|PubMed:16597617, ECO:0000269|PubMed:16844695,
ECO:0000269|PubMed:17623664, ECO:0000269|PubMed:17803937,
ECO:0000269|PubMed:18056630, ECO:0000269|PubMed:19060208,
ECO:0000269|PubMed:19103595, ECO:0000269|PubMed:21454610,
ECO:0000269|PubMed:8663044, ECO:0000269|PubMed:8961926}.
-!- INTERACTION:
P03968:FGF1 (xeno); NbExp=2; IntAct=EBI-1028658, EBI-6358090;
P05230:FGF1; NbExp=3; IntAct=EBI-1028658, EBI-698068;
O15520:FGF10; NbExp=2; IntAct=EBI-1028658, EBI-1035684;
P09038:FGF2; NbExp=3; IntAct=EBI-1028658, EBI-977447;
P09038-2:FGF2; NbExp=2; IntAct=EBI-1028658, EBI-11122080;
P21781:FGF7; NbExp=2; IntAct=EBI-6354683, EBI-3937699;
P62993:GRB2; NbExp=5; IntAct=EBI-1028658, EBI-401755;
-!- SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane
protein. Golgi apparatus. Cytoplasmic vesicle. Note=Detected on
osteoblast plasma membrane lipid rafts. After ligand binding, the
activated receptor is rapidly internalized and degraded.
-!- SUBCELLULAR LOCATION: Isoform 1: Cell membrane; Single-pass type I
membrane protein. Note=After ligand binding, the activated
receptor is rapidly internalized and degraded.
-!- SUBCELLULAR LOCATION: Isoform 3: Cell membrane; Single-pass type I
membrane protein. Note=After ligand binding, the activated
receptor is rapidly internalized and degraded.
-!- SUBCELLULAR LOCATION: Isoform 14: Secreted.
-!- SUBCELLULAR LOCATION: Isoform 19: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=23;
Name=1; Synonyms=BEK, FGFR2IIIc;
IsoId=P21802-1; Sequence=Displayed;
Name=2; Synonyms=Short;
IsoId=P21802-2; Sequence=VSP_002978;
Name=3; Synonyms=BFR-1, FGFR2IIIb, KGFR;
IsoId=P21802-3; Sequence=VSP_002969, VSP_002970, VSP_002971,
VSP_002972;
Name=4; Synonyms=K-sam;
IsoId=P21802-4; Sequence=VSP_002964, VSP_002969, VSP_002970,
VSP_002971, VSP_002972, VSP_002975,
VSP_002976;
Name=5; Synonyms=K-sam-I, BEK, IgIIIc;
IsoId=P21802-5; Sequence=VSP_002975;
Name=6; Synonyms=K-sam-IIC2;
IsoId=P21802-6; Sequence=VSP_002975, VSP_002984;
Name=7; Synonyms=K-sam-IIO2;
IsoId=P21802-7; Sequence=VSP_002969, VSP_002970, VSP_002971,
VSP_002972, VSP_002979;
Name=8; Synonyms=K-sam-IIC3;
IsoId=P21802-8; Sequence=VSP_002975, VSP_002978;
Name=9; Synonyms=K-sam-IIH1;
IsoId=P21802-9; Sequence=VSP_002969, VSP_002970, VSP_002971,
VSP_002972, VSP_002980;
Name=10; Synonyms=K-sam-IIH2;
IsoId=P21802-10; Sequence=VSP_002969, VSP_002970, VSP_002971,
VSP_002972, VSP_002981;
Name=11; Synonyms=K-sam-IIH3, K-sam-IIO4;
IsoId=P21802-11; Sequence=VSP_002969, VSP_002970, VSP_002971,
VSP_002972, VSP_002982;
Name=12; Synonyms=K-sam-IIO1;
IsoId=P21802-12; Sequence=VSP_002969, VSP_002970, VSP_002971,
VSP_002972, VSP_002983;
Name=13; Synonyms=K-sam-IIO3;
IsoId=P21802-13; Sequence=VSP_002969, VSP_002970, VSP_002971,
VSP_002972, VSP_002977;
Name=14; Synonyms=K-sam-IV, Soluble KGFR;
IsoId=P21802-14; Sequence=VSP_002965, VSP_002966;
Name=15; Synonyms=K-sam-III;
IsoId=P21802-15; Sequence=VSP_002968;
Name=16; Synonyms=TK14;
IsoId=P21802-16; Sequence=VSP_002967, VSP_002975;
Note=Ref.2 (AAA61188) sequence is in conflict in position:
315:T->L. {ECO:0000305};
Name=17;
IsoId=P21802-17; Sequence=VSP_002969, VSP_002970, VSP_002971,
VSP_002972, VSP_002978;
Name=18; Synonyms=K-sam-IIC1, KGFR, IgIIIb;
IsoId=P21802-18; Sequence=VSP_002969, VSP_002970, VSP_002971,
VSP_002972, VSP_002975;
Name=19; Synonyms=Soluble KGFR;
IsoId=P21802-19; Sequence=VSP_002969, VSP_002970, VSP_002971,
VSP_002972, VSP_002973, VSP_002974;
Name=20;
IsoId=P21802-20; Sequence=VSP_019608, VSP_019609;
Name=21;
IsoId=P21802-21; Sequence=VSP_002964, VSP_041915;
Name=22;
IsoId=P21802-22; Sequence=VSP_002964, VSP_002969, VSP_002970,
VSP_002971, VSP_002972, VSP_002978;
Name=23;
IsoId=P21802-23; Sequence=VSP_041914;
-!- DOMAIN: The second and third Ig-like domains directly interact
with fibroblast growth factors (FGF) and heparan sulfate
proteoglycans. Alternative splicing events affecting the third Ig-
like domain are crucial for ligand selectivity.
{ECO:0000269|PubMed:1309608, ECO:0000269|PubMed:1400433,
ECO:0000269|PubMed:8961926}.
-!- PTM: Autophosphorylated. Binding of FGF family members together
with heparan sulfate proteoglycan or heparin promotes receptor
dimerization and autophosphorylation on several tyrosine residues.
Autophosphorylation occurs in trans between the two FGFR molecules
present in the dimer. Phosphorylation at Tyr-769 is essential for
interaction with PLCG1. {ECO:0000269|PubMed:15629145,
ECO:0000269|PubMed:19060208}.
-!- PTM: N-glycosylated in the endoplasmic reticulum. The N-glycan
chains undergo further maturation to an Endo H-resistant form in
the Golgi apparatus. {ECO:0000269|PubMed:16844695,
ECO:0000269|PubMed:17311277}.
-!- PTM: Ubiquitinated. FGFR2 is rapidly ubiquitinated after
autophosphorylation, leading to internalization and degradation.
Subject to degradation both in lysosomes and by the proteasome.
{ECO:0000269|PubMed:15190072, ECO:0000269|PubMed:16844695,
ECO:0000269|PubMed:21596750}.
-!- DISEASE: Crouzon syndrome (CS) [MIM:123500]: An autosomal dominant
syndrome characterized by craniosynostosis, hypertelorism,
exophthalmos and external strabismus, parrot-beaked nose, short
upper lip, hypoplastic maxilla, and a relative mandibular
prognathism. {ECO:0000269|PubMed:10574673,
ECO:0000269|PubMed:11173845, ECO:0000269|PubMed:11380921,
ECO:0000269|PubMed:11781872, ECO:0000269|PubMed:17803937,
ECO:0000269|PubMed:7581378, ECO:0000269|PubMed:7655462,
ECO:0000269|PubMed:7874170, ECO:0000269|PubMed:7987400,
ECO:0000269|PubMed:8528214, ECO:0000269|PubMed:8644708,
ECO:0000269|PubMed:8946174, ECO:0000269|PubMed:8956050,
ECO:0000269|PubMed:9002682, ECO:0000269|PubMed:9152842,
ECO:0000269|PubMed:9521581, ECO:0000269|PubMed:9677057,
ECO:0000269|Ref.10}. Note=The disease is caused by mutations
affecting the gene represented in this entry.
-!- DISEASE: Jackson-Weiss syndrome (JWS) [MIM:123150]: An autosomal
dominant craniosynostosis syndrome characterized by craniofacial
abnormalities and abnormality of the feet: broad great toes with
medial deviation and tarsal-metatarsal coalescence.
{ECO:0000269|PubMed:7874170, ECO:0000269|PubMed:8528214,
ECO:0000269|PubMed:8644708, ECO:0000269|PubMed:9385368,
ECO:0000269|PubMed:9677057}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Apert syndrome (APRS) [MIM:101200]: A syndrome
characterized by facio-cranio-synostosis, osseous and membranous
syndactyly of the four extremities, and midface hypoplasia. The
craniosynostosis is bicoronal and results in acrocephaly of
brachysphenocephalic type. Syndactyly of the fingers and toes may
be total (mitten hands and sock feet) or partial affecting the
second, third, and fourth digits. Intellectual deficit is frequent
and often severe, usually being associated with cerebral
malformations. {ECO:0000269|PubMed:11390973,
ECO:0000269|PubMed:11781872, ECO:0000269|PubMed:15190072,
ECO:0000269|PubMed:7668257, ECO:0000269|PubMed:7719344,
ECO:0000269|PubMed:9002682, ECO:0000269|PubMed:9452027,
ECO:0000269|PubMed:9677057}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Pfeiffer syndrome (PS) [MIM:101600]: A syndrome
characterized by the association of craniosynostosis, broad and
deviated thumbs and big toes, and partial syndactyly of the
fingers and toes. Three subtypes are known: mild autosomal
dominant form (type 1); cloverleaf skull, elbow ankylosis, early
death, sporadic (type 2); craniosynostosis, early demise, sporadic
(type 3). {ECO:0000269|PubMed:10394936,
ECO:0000269|PubMed:10945669, ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:11781872, ECO:0000269|PubMed:16844695,
ECO:0000269|PubMed:17803937, ECO:0000269|PubMed:7719333,
ECO:0000269|PubMed:7719345, ECO:0000269|PubMed:8644708,
ECO:0000269|PubMed:9002682, ECO:0000269|PubMed:9150725,
ECO:0000269|PubMed:9693549, ECO:0000269|PubMed:9719378}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- DISEASE: Beare-Stevenson cutis gyrata syndrome (BSTVS)
[MIM:123790]: An autosomal dominant disease characterized by
craniofacial anomalies, particularly craniosynostosis, and ear
defects, cutis gyrata, acanthosis nigricans, anogenital anomalies,
skin tags, and prominent umbilical stump. The skin furrows have a
corrugated appearance and are widespread. Cutis gyrata variably
affects the scalp, forehead, face, preauricular area, neck, trunk,
hands, and feet. {ECO:0000269|PubMed:12000365,
ECO:0000269|PubMed:8696350}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Familial scaphocephaly syndrome (FSPC) [MIM:609579]: An
autosomal dominant craniosynostosis syndrome characterized by
scaphocephaly, macrocephaly, hypertelorism, maxillary retrusion,
and mild intellectual disability. Scaphocephaly is the most common
of the craniosynostosis conditions and is characterized by a long,
narrow head. It is due to premature fusion of the sagittal suture
or from external deformation. {ECO:0000269|PubMed:16061565,
ECO:0000269|PubMed:17803937}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Lacrimo-auriculo-dento-digital syndrome (LADDS)
[MIM:149730]: An autosomal dominant ectodermal dysplasia, a
heterogeneous group of disorders due to abnormal development of
two or more ectodermal structures. Lacrimo-auriculo-dento-digital
syndrome is characterized by aplastic/hypoplastic lacrimal and
salivary glands and ducts, cup-shaped ears, hearing loss,
hypodontia and enamel hypoplasia, and distal limb segments
anomalies. In addition to these cardinal features, facial
dysmorphism, malformations of the kidney and respiratory system
and abnormal genitalia have been reported. Craniosynostosis and
severe syndactyly are not observed. {ECO:0000269|PubMed:16501574,
ECO:0000269|PubMed:18056630}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Antley-Bixler syndrome, without genital anomalies or
disordered steroidogenesis (ABS2) [MIM:207410]: A rare syndrome
characterized by craniosynostosis, radiohumeral synostosis present
from the perinatal period, midface hypoplasia, choanal stenosis or
atresia, femoral bowing and multiple joint contractures.
Arachnodactyly and/or camptodactyly have also been reported.
{ECO:0000269|PubMed:10633130}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Bent bone dysplasia syndrome (BBDS) [MIM:614592]: A
perinatal lethal skeletal dysplasia characterized by poor
mineralization of the calvarium, craniosynostosis, dysmorphic
facial features, prenatal teeth, hypoplastic pubis and clavicles,
osteopenia, and bent long bones. Dysmorphic facial features
included low-set ears, hypertelorism, midface hypoplasia,
prematurely erupted fetal teeth, and micrognathia.
{ECO:0000269|PubMed:22387015}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Saethre-Chotzen syndrome (SCS) [MIM:101400]: A
craniosynostosis syndrome characterized by coronal synostosis,
brachycephaly, low frontal hairline, facial asymmetry,
hypertelorism, broad halluces, and clinodactyly.
{ECO:0000269|PubMed:9585583}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the protein kinase superfamily. Tyr protein
kinase family. Fibroblast growth factor receptor subfamily.
{ECO:0000255|PROSITE-ProRule:PRU00159}.
-!- SEQUENCE CAUTION:
Sequence=BAG57383.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
URL="http://atlasgeneticsoncology.org/Genes/FGFR2ID40570ch10q26.html";
-!- WEB RESOURCE: Name=NIEHS-SNPs;
URL="http://egp.gs.washington.edu/data/fgfr2/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X52832; CAA37014.1; -; mRNA.
EMBL; M55614; AAA61188.1; -; mRNA.
EMBL; X56191; CAA39654.1; -; mRNA.
EMBL; M35718; AAA36152.1; -; mRNA.
EMBL; M87770; AAA59470.1; -; mRNA.
EMBL; M87771; AAA59471.1; -; mRNA.
EMBL; M87772; AAA59472.1; -; mRNA.
EMBL; M97193; AAA52449.1; -; mRNA.
EMBL; U11814; AAA68514.1; -; mRNA.
EMBL; M80634; AAA36147.1; -; mRNA.
EMBL; Z71929; CAA96492.1; -; mRNA.
EMBL; AB030073; BAA89296.1; -; mRNA.
EMBL; AB030074; BAA89297.1; -; mRNA.
EMBL; AB030075; BAA89298.1; -; mRNA.
EMBL; AB030076; BAA89299.1; -; mRNA.
EMBL; AB030077; BAA89300.1; -; mRNA.
EMBL; AB030078; BAA89301.1; -; mRNA.
EMBL; AF360695; AAK94205.1; -; Genomic_DNA.
EMBL; AF410480; AAK94205.1; JOINED; Genomic_DNA.
EMBL; AF360695; AAK94206.1; -; Genomic_DNA.
EMBL; AF410480; AAK94206.1; JOINED; Genomic_DNA.
EMBL; AF360695; AAK94207.1; -; Genomic_DNA.
EMBL; AF410480; AAK94207.1; JOINED; Genomic_DNA.
EMBL; AF360695; AAK94208.1; -; Genomic_DNA.
EMBL; AF410480; AAK94208.1; JOINED; Genomic_DNA.
EMBL; AF360695; AAK94209.1; -; Genomic_DNA.
EMBL; AF410480; AAK94209.1; JOINED; Genomic_DNA.
EMBL; AF487553; AAM74056.1; -; Genomic_DNA.
EMBL; AB084153; BAC45037.1; -; mRNA.
EMBL; DQ493927; ABE96832.1; -; Genomic_DNA.
EMBL; AK294026; BAG57383.1; ALT_INIT; mRNA.
EMBL; AC009988; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC039243; AAH39243.2; -; mRNA.
EMBL; AF169399; AAF43273.1; -; Genomic_DNA.
EMBL; AF169399; AAF43274.1; -; Genomic_DNA.
EMBL; AF097353; AAD31560.1; -; Genomic_DNA.
EMBL; AF097341; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097342; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097343; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097345; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097346; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097347; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097348; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097349; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097350; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097351; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097352; AAD31560.1; JOINED; Genomic_DNA.
EMBL; AF097353; AAD31561.1; -; Genomic_DNA.
EMBL; AF097341; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097342; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097344; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097345; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097346; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097347; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097348; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097349; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097350; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097351; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097352; AAD31561.1; JOINED; Genomic_DNA.
EMBL; AF097340; AAD31562.1; -; Genomic_DNA.
EMBL; AF097337; AAD31562.1; JOINED; Genomic_DNA.
EMBL; AF097338; AAD31562.1; JOINED; Genomic_DNA.
EMBL; AF097339; AAD31562.1; JOINED; Genomic_DNA.
EMBL; AF097354; AAD31565.1; -; Genomic_DNA.
EMBL; AF097341; AAD31567.1; -; Genomic_DNA.
EMBL; S82438; AAD14392.1; -; Genomic_DNA.
EMBL; Y17131; CAA76643.1; -; Genomic_DNA.
EMBL; L49237; AAC41933.1; -; Genomic_DNA.
EMBL; L49242; AAC41934.1; -; Genomic_DNA.
EMBL; L49238; AAC41935.1; -; Genomic_DNA.
EMBL; L49239; AAC41936.1; -; Genomic_DNA.
EMBL; L49240; AAC41937.1; -; Genomic_DNA.
EMBL; L49241; AAC41938.1; -; Genomic_DNA.
CCDS; CCDS31298.1; -. [P21802-1]
CCDS; CCDS44485.1; -. [P21802-20]
CCDS; CCDS44486.1; -. [P21802-23]
CCDS; CCDS44487.1; -. [P21802-15]
CCDS; CCDS44488.1; -. [P21802-22]
CCDS; CCDS44489.1; -. [P21802-17]
CCDS; CCDS53584.1; -. [P21802-21]
CCDS; CCDS7620.2; -. [P21802-3]
CCDS; CCDS81515.1; -. [P21802-5]
PIR; A35969; A35969.
PIR; A42691; TVHUF2.
PIR; A45081; A45081.
PIR; C42691; C42691.
PIR; S16236; S16236.
RefSeq; NP_000132.3; NM_000141.4. [P21802-1]
RefSeq; NP_001138385.1; NM_001144913.1. [P21802-17]
RefSeq; NP_001138386.1; NM_001144914.1. [P21802-23]
RefSeq; NP_001138387.1; NM_001144915.1. [P21802-21]
RefSeq; NP_001138388.1; NM_001144916.1.
RefSeq; NP_001138389.1; NM_001144917.1. [P21802-15]
RefSeq; NP_001138390.1; NM_001144918.1. [P21802-20]
RefSeq; NP_001138391.1; NM_001144919.1. [P21802-22]
RefSeq; NP_001307583.1; NM_001320654.1.
RefSeq; NP_001307587.1; NM_001320658.1. [P21802-5]
RefSeq; NP_075259.4; NM_022970.3. [P21802-3]
RefSeq; NP_075418.1; NM_023029.2.
UniGene; Hs.533683; -.
PDB; 1DJS; X-ray; 2.40 A; A=32-362.
PDB; 1E0O; X-ray; 2.80 A; B/D=148-366.
PDB; 1EV2; X-ray; 2.20 A; E/F/G/H=147-366.
PDB; 1GJO; X-ray; 2.40 A; A=456-768.
PDB; 1II4; X-ray; 2.70 A; E/F/G/H=147-366.
PDB; 1IIL; X-ray; 2.30 A; E/F/G/H=147-366.
PDB; 1NUN; X-ray; 2.90 A; B=140-368.
PDB; 1OEC; X-ray; 2.40 A; A=456-768.
PDB; 1WVZ; NMR; -; A=147-249.
PDB; 2FDB; X-ray; 2.28 A; P/R=149-368.
PDB; 2PSQ; X-ray; 2.40 A; A/B=413-768.
PDB; 2PVF; X-ray; 1.80 A; A=458-778, B=764-778.
PDB; 2PVY; X-ray; 2.20 A; A/B/C/D=458-768.
PDB; 2PWL; X-ray; 2.40 A; A/B=458-768.
PDB; 2PY3; X-ray; 2.30 A; A/B=458-768.
PDB; 2PZ5; X-ray; 2.40 A; A/B=458-768.
PDB; 2PZP; X-ray; 2.40 A; A/B=458-768.
PDB; 2PZR; X-ray; 3.00 A; A/B=458-768.
PDB; 2Q0B; X-ray; 2.90 A; A/B=458-768.
PDB; 3B2T; X-ray; 1.80 A; A/B=458-766.
PDB; 3CAF; X-ray; 1.96 A; A=150-249.
PDB; 3CLY; X-ray; 2.00 A; A=458-778.
PDB; 3CU1; X-ray; 2.60 A; A/C=150-249.
PDB; 3DAR; X-ray; 2.20 A; A/B=146-249.
PDB; 3EUU; X-ray; 2.34 A; A/B=150-249.
PDB; 3OJ2; X-ray; 2.20 A; C/D=140-313.
PDB; 3OJM; X-ray; 2.10 A; B=140-313.
PDB; 3RI1; X-ray; 2.10 A; A/B=458-768.
PDB; 4J23; X-ray; 3.88 A; A=147-366.
PDB; 4J95; X-ray; 2.38 A; A/B/C/D=458-768.
PDB; 4J96; X-ray; 2.30 A; A/B=458-768.
PDB; 4J97; X-ray; 2.55 A; A/B/C/D=458-768.
PDB; 4J98; X-ray; 2.31 A; A/B=458-768.
PDB; 4J99; X-ray; 1.85 A; A/B/C/D=458-768.
PDB; 4WV1; X-ray; 2.36 A; C/F=153-251.
PDB; 5EG3; X-ray; 2.61 A; A=458-778.
PDB; 5UGL; X-ray; 1.86 A; A/B=458-768.
PDB; 5UGX; X-ray; 2.35 A; A/B=458-768.
PDB; 5UHN; X-ray; 2.91 A; A/B=458-768.
PDB; 5UI0; X-ray; 2.05 A; A/B=458-768.
PDBsum; 1DJS; -.
PDBsum; 1E0O; -.
PDBsum; 1EV2; -.
PDBsum; 1GJO; -.
PDBsum; 1II4; -.
PDBsum; 1IIL; -.
PDBsum; 1NUN; -.
PDBsum; 1OEC; -.
PDBsum; 1WVZ; -.
PDBsum; 2FDB; -.
PDBsum; 2PSQ; -.
PDBsum; 2PVF; -.
PDBsum; 2PVY; -.
PDBsum; 2PWL; -.
PDBsum; 2PY3; -.
PDBsum; 2PZ5; -.
PDBsum; 2PZP; -.
PDBsum; 2PZR; -.
PDBsum; 2Q0B; -.
PDBsum; 3B2T; -.
PDBsum; 3CAF; -.
PDBsum; 3CLY; -.
PDBsum; 3CU1; -.
PDBsum; 3DAR; -.
PDBsum; 3EUU; -.
PDBsum; 3OJ2; -.
PDBsum; 3OJM; -.
PDBsum; 3RI1; -.
PDBsum; 4J23; -.
PDBsum; 4J95; -.
PDBsum; 4J96; -.
PDBsum; 4J97; -.
PDBsum; 4J98; -.
PDBsum; 4J99; -.
PDBsum; 4WV1; -.
PDBsum; 5EG3; -.
PDBsum; 5UGL; -.
PDBsum; 5UGX; -.
PDBsum; 5UHN; -.
PDBsum; 5UI0; -.
ProteinModelPortal; P21802; -.
SMR; P21802; -.
BioGrid; 108554; 81.
DIP; DIP-3788N; -.
IntAct; P21802; 28.
MINT; MINT-118359; -.
STRING; 9606.ENSP00000410294; -.
BindingDB; P21802; -.
ChEMBL; CHEMBL4142; -.
DrugBank; DB02491; 4-[4-(1-Amino-1-Methylethyl)Phenyl]-5-Chloro-N-[4-(2-Morpholin-4-Ylethyl)Phenyl]Pyrimidin-2-Amine.
DrugBank; DB09078; Lenvatinib.
DrugBank; DB09079; Nintedanib.
DrugBank; DB00039; Palifermin.
DrugBank; DB08901; Ponatinib.
DrugBank; DB08896; Regorafenib.
DrugBank; DB02058; SU4984.
DrugBank; DB01041; Thalidomide.
GuidetoPHARMACOLOGY; 1809; -.
iPTMnet; P21802; -.
PhosphoSitePlus; P21802; -.
BioMuta; FGFR2; -.
DMDM; 120049; -.
PaxDb; P21802; -.
PeptideAtlas; P21802; -.
PRIDE; P21802; -.
TopDownProteomics; P21802-8; -. [P21802-8]
Ensembl; ENST00000346997; ENSP00000263451; ENSG00000066468. [P21802-5]
Ensembl; ENST00000356226; ENSP00000348559; ENSG00000066468. [P21802-20]
Ensembl; ENST00000357555; ENSP00000350166; ENSG00000066468. [P21802-21]
Ensembl; ENST00000358487; ENSP00000351276; ENSG00000066468. [P21802-1]
Ensembl; ENST00000359354; ENSP00000352309; ENSG00000066468. [P21802-14]
Ensembl; ENST00000360144; ENSP00000353262; ENSG00000066468. [P21802-22]
Ensembl; ENST00000369056; ENSP00000358052; ENSG00000066468. [P21802-17]
Ensembl; ENST00000369058; ENSP00000358054; ENSG00000066468. [P21802-13]
Ensembl; ENST00000369060; ENSP00000358056; ENSG00000066468. [P21802-15]
Ensembl; ENST00000369061; ENSP00000358057; ENSG00000066468. [P21802-23]
Ensembl; ENST00000457416; ENSP00000410294; ENSG00000066468. [P21802-3]
GeneID; 2263; -.
KEGG; hsa:2263; -.
UCSC; uc010qtl.3; human. [P21802-1]
CTD; 2263; -.
DisGeNET; 2263; -.
GeneCards; FGFR2; -.
GeneReviews; FGFR2; -.
HGNC; HGNC:3689; FGFR2.
HPA; CAB010886; -.
HPA; HPA035305; -.
HPA; HPA056562; -.
MalaCards; FGFR2; -.
MIM; 101200; phenotype.
MIM; 101400; phenotype.
MIM; 101600; phenotype.
MIM; 123150; phenotype.
MIM; 123500; phenotype.
MIM; 123790; phenotype.
MIM; 149730; phenotype.
MIM; 176943; gene.
MIM; 207410; phenotype.
MIM; 609579; phenotype.
MIM; 614592; phenotype.
neXtProt; NX_P21802; -.
OpenTargets; ENSG00000066468; -.
Orphanet; 83; Antley-Bixler syndrome.
Orphanet; 87; Apert syndrome.
Orphanet; 207; Crouzon disease.
Orphanet; 1555; Cutis gyrata - acanthosis nigricans - craniosynostosis.
Orphanet; 168624; Familial scaphocephaly syndrome, McGillivray type.
Orphanet; 313855; FGFR2-related bent bone dysplasia.
Orphanet; 1540; Jackson-Weiss syndrome.
Orphanet; 2363; Lacrimoauriculodentodigital syndrome.
Orphanet; 93258; Pfeiffer syndrome type 1.
Orphanet; 93259; Pfeiffer syndrome type 2.
Orphanet; 93260; Pfeiffer syndrome type 3.
Orphanet; 794; Saethre-Chotzen syndrome.
PharmGKB; PA28128; -.
eggNOG; KOG0200; Eukaryota.
eggNOG; COG0515; LUCA.
GeneTree; ENSGT00760000118923; -.
HOGENOM; HOG000263410; -.
HOVERGEN; HBG000345; -.
InParanoid; P21802; -.
KO; K05093; -.
OrthoDB; EOG091G0CQZ; -.
PhylomeDB; P21802; -.
TreeFam; TF316307; -.
BRENDA; 2.7.10.1; 2681.
Reactome; R-HSA-109704; PI3K Cascade.
Reactome; R-HSA-1257604; PIP3 activates AKT signaling.
Reactome; R-HSA-190375; FGFR2c ligand binding and activation.
Reactome; R-HSA-190377; FGFR2b ligand binding and activation.
Reactome; R-HSA-2023837; Signaling by FGFR2 amplification mutants.
Reactome; R-HSA-2033519; Activated point mutants of FGFR2.
Reactome; R-HSA-2219530; Constitutive Signaling by Aberrant PI3K in Cancer.
Reactome; R-HSA-5654221; Phospholipase C-mediated cascade, FGFR2.
Reactome; R-HSA-5654695; PI-3K cascade:FGFR2.
Reactome; R-HSA-5654699; SHC-mediated cascade:FGFR2.
Reactome; R-HSA-5654700; FRS-mediated FGFR2 signaling.
Reactome; R-HSA-5654727; Negative regulation of FGFR2 signaling.
Reactome; R-HSA-5655253; Signaling by FGFR2 in disease.
Reactome; R-HSA-5673001; RAF/MAP kinase cascade.
Reactome; R-HSA-6811558; PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.
Reactome; R-HSA-8851708; Signaling by FGFR2 IIIa TM.
Reactome; R-HSA-8853333; Signaling by FGFR2 fusions.
SignaLink; P21802; -.
SIGNOR; P21802; -.
ChiTaRS; FGFR2; human.
EvolutionaryTrace; P21802; -.
GeneWiki; Fibroblast_growth_factor_receptor_2; -.
GenomeRNAi; 2263; -.
PRO; PR:P21802; -.
Proteomes; UP000005640; Chromosome 10.
Bgee; ENSG00000066468; -.
ExpressionAtlas; P21802; baseline and differential.
Genevisible; P21802; HS.
GO; GO:0005938; C:cell cortex; IDA:UniProtKB.
GO; GO:0009986; C:cell surface; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0031410; C:cytoplasmic vesicle; IEA:UniProtKB-KW.
GO; GO:0060076; C:excitatory synapse; ISS:UniProtKB.
GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
GO; GO:0005794; C:Golgi apparatus; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; NAS:UniProtKB.
GO; GO:0005887; C:integral component of plasma membrane; IDA:UniProtKB.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
GO; GO:0016020; C:membrane; NAS:UniProtKB.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0016303; F:1-phosphatidylinositol-3-kinase activity; TAS:Reactome.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0017134; F:fibroblast growth factor binding; IDA:UniProtKB.
GO; GO:0005007; F:fibroblast growth factor-activated receptor activity; IDA:UniProtKB.
GO; GO:0008201; F:heparin binding; IEA:UniProtKB-KW.
GO; GO:0046934; F:phosphatidylinositol-4,5-bisphosphate 3-kinase activity; TAS:Reactome.
GO; GO:0042803; F:protein homodimerization activity; IPI:UniProtKB.
GO; GO:0004713; F:protein tyrosine kinase activity; TAS:Reactome.
GO; GO:0005088; F:Ras guanyl-nucleotide exchange factor activity; TAS:Reactome.
GO; GO:0001525; P:angiogenesis; ISS:UniProtKB.
GO; GO:0009887; P:animal organ morphogenesis; ISS:UniProtKB.
GO; GO:0006915; P:apoptotic process; IEA:UniProtKB-KW.
GO; GO:0007409; P:axonogenesis; ISS:UniProtKB.
GO; GO:0060348; P:bone development; ISS:UniProtKB.
GO; GO:0030282; P:bone mineralization; ISS:UniProtKB.
GO; GO:0060349; P:bone morphogenesis; ISS:UniProtKB.
GO; GO:0060667; P:branch elongation involved in salivary gland morphogenesis; ISS:UniProtKB.
GO; GO:0060670; P:branching involved in labyrinthine layer morphogenesis; ISS:UniProtKB.
GO; GO:0060442; P:branching involved in prostate gland morphogenesis; ISS:UniProtKB.
GO; GO:0060445; P:branching involved in salivary gland morphogenesis; ISS:UniProtKB.
GO; GO:0048755; P:branching morphogenesis of a nerve; ISS:UniProtKB.
GO; GO:0060449; P:bud elongation involved in lung branching; ISS:UniProtKB.
GO; GO:0045165; P:cell fate commitment; ISS:UniProtKB.
GO; GO:0007267; P:cell-cell signaling; ISS:UniProtKB.
GO; GO:0071300; P:cellular response to retinoic acid; IEA:Ensembl.
GO; GO:0071560; P:cellular response to transforming growth factor beta stimulus; IEA:Ensembl.
GO; GO:0048565; P:digestive tract development; ISS:UniProtKB.
GO; GO:0048701; P:embryonic cranial skeleton morphogenesis; IMP:BHF-UCL.
GO; GO:0048557; P:embryonic digestive tract morphogenesis; ISS:UniProtKB.
GO; GO:0048568; P:embryonic organ development; ISS:UniProtKB.
GO; GO:0048562; P:embryonic organ morphogenesis; ISS:UniProtKB.
GO; GO:0009880; P:embryonic pattern specification; ISS:UniProtKB.
GO; GO:0003416; P:endochondral bone growth; IEA:Ensembl.
GO; GO:0048730; P:epidermis morphogenesis; ISS:UniProtKB.
GO; GO:0030855; P:epithelial cell differentiation; ISS:UniProtKB.
GO; GO:0060664; P:epithelial cell proliferation involved in salivary gland morphogenesis; ISS:UniProtKB.
GO; GO:0001837; P:epithelial to mesenchymal transition; IEA:Ensembl.
GO; GO:0008543; P:fibroblast growth factor receptor signaling pathway; IDA:UniProtKB.
GO; GO:0035603; P:fibroblast growth factor receptor signaling pathway involved in hemopoiesis; ISS:UniProtKB.
GO; GO:0060595; P:fibroblast growth factor receptor signaling pathway involved in mammary gland specification; ISS:UniProtKB.
GO; GO:0035602; P:fibroblast growth factor receptor signaling pathway involved in negative regulation of apoptotic process in bone marrow; ISS:UniProtKB.
GO; GO:0035607; P:fibroblast growth factor receptor signaling pathway involved in orbitofrontal cortex development; ISS:UniProtKB.
GO; GO:0035604; P:fibroblast growth factor receptor signaling pathway involved in positive regulation of cell proliferation in bone marrow; ISS:UniProtKB.
GO; GO:0022612; P:gland morphogenesis; ISS:UniProtKB.
GO; GO:0031069; P:hair follicle morphogenesis; ISS:UniProtKB.
GO; GO:0001701; P:in utero embryonic development; ISS:UniProtKB.
GO; GO:0042472; P:inner ear morphogenesis; ISS:UniProtKB.
GO; GO:0032808; P:lacrimal gland development; ISS:UniProtKB.
GO; GO:0060601; P:lateral sprouting from an epithelium; ISS:UniProtKB.
GO; GO:0060174; P:limb bud formation; ISS:UniProtKB.
GO; GO:0048286; P:lung alveolus development; ISS:UniProtKB.
GO; GO:0030324; P:lung development; ISS:UniProtKB.
GO; GO:0060463; P:lung lobe morphogenesis; ISS:UniProtKB.
GO; GO:0060484; P:lung-associated mesenchyme development; ISS:UniProtKB.
GO; GO:0060615; P:mammary gland bud formation; ISS:UniProtKB.
GO; GO:0000165; P:MAPK cascade; TAS:Reactome.
GO; GO:0003149; P:membranous septum morphogenesis; ISS:UniProtKB.
GO; GO:0048762; P:mesenchymal cell differentiation; ISS:UniProtKB.
GO; GO:0060915; P:mesenchymal cell differentiation involved in lung development; ISS:UniProtKB.
GO; GO:0060916; P:mesenchymal cell proliferation involved in lung development; ISS:UniProtKB.
GO; GO:0048333; P:mesodermal cell differentiation; IEA:Ensembl.
GO; GO:0030901; P:midbrain development; ISS:UniProtKB.
GO; GO:0016331; P:morphogenesis of embryonic epithelium; ISS:UniProtKB.
GO; GO:0035264; P:multicellular organism growth; ISS:UniProtKB.
GO; GO:0050680; P:negative regulation of epithelial cell proliferation; IEA:Ensembl.
GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; ISS:UniProtKB.
GO; GO:0042476; P:odontogenesis; ISS:UniProtKB.
GO; GO:0021769; P:orbitofrontal cortex development; ISS:UniProtKB.
GO; GO:0035265; P:organ growth; ISS:UniProtKB.
GO; GO:0030916; P:otic vesicle formation; ISS:UniProtKB.
GO; GO:0003148; P:outflow tract septum morphogenesis; ISS:UniProtKB.
GO; GO:0018108; P:peptidyl-tyrosine phosphorylation; IDA:UniProtKB.
GO; GO:0048015; P:phosphatidylinositol-mediated signaling; TAS:Reactome.
GO; GO:0090263; P:positive regulation of canonical Wnt signaling pathway; ISS:UniProtKB.
GO; GO:0060045; P:positive regulation of cardiac muscle cell proliferation; ISS:UniProtKB.
GO; GO:0045787; P:positive regulation of cell cycle; ISS:UniProtKB.
GO; GO:0051781; P:positive regulation of cell division; ISS:UniProtKB.
GO; GO:0008284; P:positive regulation of cell proliferation; IDA:UniProtKB.
GO; GO:0050679; P:positive regulation of epithelial cell proliferation; ISS:UniProtKB.
GO; GO:0060501; P:positive regulation of epithelial cell proliferation involved in lung morphogenesis; ISS:UniProtKB.
GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; ISS:UniProtKB.
GO; GO:0043410; P:positive regulation of MAPK cascade; IMP:UniProtKB.
GO; GO:0002053; P:positive regulation of mesenchymal cell proliferation; ISS:UniProtKB.
GO; GO:0010518; P:positive regulation of phospholipase activity; IMP:UniProtKB.
GO; GO:0048661; P:positive regulation of smooth muscle cell proliferation; IEA:Ensembl.
GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; ISS:UniProtKB.
GO; GO:0030177; P:positive regulation of Wnt signaling pathway; ISS:UniProtKB.
GO; GO:0009791; P:post-embryonic development; ISS:UniProtKB.
GO; GO:0060527; P:prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis; ISS:UniProtKB.
GO; GO:0060523; P:prostate epithelial cord elongation; ISS:UniProtKB.
GO; GO:0060512; P:prostate gland morphogenesis; ISS:UniProtKB.
GO; GO:0046777; P:protein autophosphorylation; IDA:UniProtKB.
GO; GO:0021860; P:pyramidal neuron development; ISS:UniProtKB.
GO; GO:0060687; P:regulation of branching involved in prostate gland morphogenesis; ISS:UniProtKB.
GO; GO:0010453; P:regulation of cell fate commitment; ISS:UniProtKB.
GO; GO:0070372; P:regulation of ERK1 and ERK2 cascade; ISS:UniProtKB.
GO; GO:0040036; P:regulation of fibroblast growth factor receptor signaling pathway; ISS:UniProtKB.
GO; GO:0060688; P:regulation of morphogenesis of a branching structure; ISS:UniProtKB.
GO; GO:0040014; P:regulation of multicellular organism growth; ISS:UniProtKB.
GO; GO:0045667; P:regulation of osteoblast differentiation; TAS:UniProtKB.
GO; GO:0033688; P:regulation of osteoblast proliferation; TAS:UniProtKB.
GO; GO:0014066; P:regulation of phosphatidylinositol 3-kinase signaling; TAS:Reactome.
GO; GO:0051150; P:regulation of smooth muscle cell differentiation; ISS:UniProtKB.
GO; GO:0008589; P:regulation of smoothened signaling pathway; ISS:UniProtKB.
GO; GO:0048608; P:reproductive structure development; ISS:UniProtKB.
GO; GO:0045471; P:response to ethanol; IEA:Ensembl.
GO; GO:0032496; P:response to lipopolysaccharide; IEA:Ensembl.
GO; GO:0048705; P:skeletal system morphogenesis; TAS:UniProtKB.
GO; GO:0060529; P:squamous basal epithelial stem cell differentiation involved in prostate gland acinus development; ISS:UniProtKB.
GO; GO:0001657; P:ureteric bud development; ISS:UniProtKB.
GO; GO:0055010; P:ventricular cardiac muscle tissue morphogenesis; ISS:UniProtKB.
GO; GO:0021847; P:ventricular zone neuroblast division; ISS:UniProtKB.
GO; GO:0042060; P:wound healing; IEA:Ensembl.
Gene3D; 2.60.40.10; -; 3.
InterPro; IPR028175; FGF_rcpt_2.
InterPro; IPR016248; FGF_rcpt_fam.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR013098; Ig_I-set.
InterPro; IPR003599; Ig_sub.
InterPro; IPR003598; Ig_sub2.
InterPro; IPR011009; Kinase-like_dom.
InterPro; IPR000719; Prot_kinase_dom.
InterPro; IPR017441; Protein_kinase_ATP_BS.
InterPro; IPR001245; Ser-Thr/Tyr_kinase_cat_dom.
InterPro; IPR008266; Tyr_kinase_AS.
InterPro; IPR020635; Tyr_kinase_cat_dom.
PANTHER; PTHR24416:SF468; PTHR24416:SF468; 1.
Pfam; PF07679; I-set; 2.
Pfam; PF07714; Pkinase_Tyr; 1.
PIRSF; PIRSF000628; FGFR; 1.
PRINTS; PR00109; TYRKINASE.
SMART; SM00409; IG; 3.
SMART; SM00408; IGc2; 3.
SMART; SM00219; TyrKc; 1.
SUPFAM; SSF48726; SSF48726; 3.
SUPFAM; SSF56112; SSF56112; 1.
PROSITE; PS50835; IG_LIKE; 3.
PROSITE; PS00107; PROTEIN_KINASE_ATP; 1.
PROSITE; PS50011; PROTEIN_KINASE_DOM; 1.
PROSITE; PS00109; PROTEIN_KINASE_TYR; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Apoptosis; ATP-binding;
Cell membrane; Complete proteome; Craniosynostosis;
Cytoplasmic vesicle; Disease mutation; Disulfide bond;
Ectodermal dysplasia; Glycoprotein; Golgi apparatus; Heparin-binding;
Immunoglobulin domain; Kinase;
Lacrimo-auriculo-dento-digital syndrome; Membrane; Mental retardation;
Nucleotide-binding; Phosphoprotein; Polymorphism; Proto-oncogene;
Receptor; Reference proteome; Repeat; Secreted; Signal; Transferase;
Transmembrane; Transmembrane helix; Tyrosine-protein kinase;
Ubl conjugation.
SIGNAL 1 21 {ECO:0000255}.
CHAIN 22 821 Fibroblast growth factor receptor 2.
/FTId=PRO_0000016783.
TOPO_DOM 22 377 Extracellular. {ECO:0000255}.
TRANSMEM 378 398 Helical. {ECO:0000255}.
TOPO_DOM 399 821 Cytoplasmic. {ECO:0000255}.
DOMAIN 25 125 Ig-like C2-type 1.
DOMAIN 154 247 Ig-like C2-type 2.
DOMAIN 256 358 Ig-like C2-type 3.
DOMAIN 481 770 Protein kinase. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
NP_BIND 487 495 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159,
ECO:0000269|PubMed:19060208}.
NP_BIND 565 567 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159,
ECO:0000269|PubMed:19060208}.
REGION 161 178 Heparin-binding.
ACT_SITE 626 626 Proton acceptor. {ECO:0000255|PROSITE-
ProRule:PRU00159, ECO:0000255|PROSITE-
ProRule:PRU10028,
ECO:0000269|PubMed:19060208}.
BINDING 517 517 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159,
ECO:0000269|PubMed:19060208}.
BINDING 571 571 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159,
ECO:0000269|PubMed:19060208}.
MOD_RES 466 466 Phosphotyrosine; by autocatalysis.
{ECO:0000269|PubMed:19060208,
ECO:0000269|PubMed:19410646}.
MOD_RES 586 586 Phosphotyrosine; by autocatalysis.
{ECO:0000269|PubMed:17803937,
ECO:0000269|PubMed:19060208,
ECO:0000269|PubMed:19410646}.
MOD_RES 588 588 Phosphotyrosine; by autocatalysis.
{ECO:0000269|PubMed:19060208,
ECO:0000269|PubMed:19410646}.
MOD_RES 656 656 Phosphotyrosine; by autocatalysis.
{ECO:0000269|PubMed:17803937,
ECO:0000269|PubMed:19060208,
ECO:0000269|PubMed:19410646}.
MOD_RES 657 657 Phosphotyrosine; by autocatalysis.
{ECO:0000269|PubMed:17803937,
ECO:0000269|PubMed:19060208,
ECO:0000269|PubMed:19410646}.
MOD_RES 769 769 Phosphotyrosine; by autocatalysis.
{ECO:0000269|PubMed:15629145,
ECO:0000269|PubMed:19060208}.
MOD_RES 780 780 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
CARBOHYD 83 83 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 123 123 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 228 228 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 241 241 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 265 265 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 297 297 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 318 318 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 331 331 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 62 107 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 179 231 {ECO:0000255|PROSITE-ProRule:PRU00114,
ECO:0000269|PubMed:16384934}.
DISULFID 278 342 {ECO:0000255|PROSITE-ProRule:PRU00114,
ECO:0000269|PubMed:16384934}.
VAR_SEQ 37 152 EPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGV
HLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETW
YFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKR -> G
(in isoform 20).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_019608.
VAR_SEQ 37 125 Missing (in isoform 4, isoform 21 and
isoform 22).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:2377625}.
/FTId=VSP_002964.
VAR_SEQ 250 361 Missing (in isoform 23).
{ECO:0000303|Ref.14}.
/FTId=VSP_041914.
VAR_SEQ 250 254 ERSPH -> GSQGL (in isoform 14).
{ECO:0000303|PubMed:1313574}.
/FTId=VSP_002965.
VAR_SEQ 255 821 Missing (in isoform 14).
{ECO:0000303|PubMed:1313574}.
/FTId=VSP_002966.
VAR_SEQ 313 313 K -> KVTK (in isoform 16).
{ECO:0000303|PubMed:2172978}.
/FTId=VSP_002967.
VAR_SEQ 314 429 Missing (in isoform 15).
{ECO:0000303|PubMed:1313574}.
/FTId=VSP_002968.
VAR_SEQ 314 330 AAGVNTTDKEIEVLYIR -> HSGINSSNAEVLALF (in
isoform 3, isoform 4, isoform 7, isoform
9, isoform 10, isoform 11, isoform 12,
isoform 13, isoform 17, isoform 18,
isoform 19 and isoform 22).
{ECO:0000303|PubMed:10626794,
ECO:0000303|PubMed:1309608,
ECO:0000303|PubMed:1400433,
ECO:0000303|PubMed:1647213,
ECO:0000303|PubMed:2377625,
ECO:0000303|PubMed:7866434}.
/FTId=VSP_002969.
VAR_SEQ 334 335 FE -> EA (in isoform 3, isoform 4,
isoform 7, isoform 9, isoform 10, isoform
11, isoform 12, isoform 13, isoform 17,
isoform 18, isoform 19 and isoform 22).
{ECO:0000303|PubMed:10626794,
ECO:0000303|PubMed:1309608,
ECO:0000303|PubMed:1400433,
ECO:0000303|PubMed:1647213,
ECO:0000303|PubMed:2377625,
ECO:0000303|PubMed:7866434}.
/FTId=VSP_002970.
VAR_SEQ 341 353 TCLAGNSIGISFH -> ICKVSNYIGQANQ (in
isoform 3, isoform 4, isoform 7, isoform
9, isoform 10, isoform 11, isoform 12,
isoform 13, isoform 17, isoform 18,
isoform 19 and isoform 22).
{ECO:0000303|PubMed:10626794,
ECO:0000303|PubMed:1309608,
ECO:0000303|PubMed:1400433,
ECO:0000303|PubMed:1647213,
ECO:0000303|PubMed:2377625,
ECO:0000303|PubMed:7866434}.
/FTId=VSP_002971.
VAR_SEQ 361 361 P -> PKQQ (in isoform 3, isoform 4,
isoform 7, isoform 9, isoform 10, isoform
11, isoform 12, isoform 13, isoform 17,
isoform 18, isoform 19 and isoform 22).
{ECO:0000303|PubMed:10626794,
ECO:0000303|PubMed:1309608,
ECO:0000303|PubMed:1400433,
ECO:0000303|PubMed:1647213,
ECO:0000303|PubMed:2377625,
ECO:0000303|PubMed:7866434}.
/FTId=VSP_002972.
VAR_SEQ 362 365 APGR -> GRRC (in isoform 19).
{ECO:0000303|PubMed:1309608,
ECO:0000303|PubMed:7866434}.
/FTId=VSP_002973.
VAR_SEQ 366 821 Missing (in isoform 19).
{ECO:0000303|PubMed:1309608,
ECO:0000303|PubMed:7866434}.
/FTId=VSP_002974.
VAR_SEQ 428 429 Missing (in isoform 4, isoform 5, isoform
6, isoform 8, isoform 16 and isoform 18).
{ECO:0000303|PubMed:1313574,
ECO:0000303|PubMed:2172978,
ECO:0000303|PubMed:2377625}.
/FTId=VSP_002975.
VAR_SEQ 429 430 Missing (in isoform 20).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_019609.
VAR_SEQ 761 821 LTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPD
PMPYEPCLPQYPHINGSVKT -> PPNPSLMSIFRK (in
isoform 4). {ECO:0000303|PubMed:2377625}.
/FTId=VSP_002976.
VAR_SEQ 768 821 EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPC
LPQYPHINGSVKT -> SFQSSLKSSSTGIPGWPPGSEVFS
EVAFRGILNYDIERPILCAGSKKIYDI (in isoform
10). {ECO:0000303|PubMed:10626794}.
/FTId=VSP_002981.
VAR_SEQ 768 821 EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPC
LPQYPHINGSVKT -> GRLPAWASQEKENSQTSLFAISHV
TLSSISKTRSSAKRDEKPGSSPHLALVRSQGLPQSVVP
(in isoform 11).
{ECO:0000303|PubMed:10626794}.
/FTId=VSP_002982.
VAR_SEQ 768 821 EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPC
LPQYPHINGSVKT -> PLS (in isoform 12).
{ECO:0000303|PubMed:10626794}.
/FTId=VSP_002983.
VAR_SEQ 768 821 Missing (in isoform 13).
{ECO:0000303|PubMed:10626794}.
/FTId=VSP_002977.
VAR_SEQ 768 821 EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPC
LPQYPHINGSVKT -> I (in isoform 2, isoform
8, isoform 17 and isoform 22).
{ECO:0000303|PubMed:1647213}.
/FTId=VSP_002978.
VAR_SEQ 768 821 EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPC
LPQYPHINGSVKT -> RYKLLPCPDKHNKRCKPEERGDLT
EAGAAGSSRCVDSRKRVRQEKISTG (in isoform 7).
{ECO:0000303|PubMed:10626794}.
/FTId=VSP_002979.
VAR_SEQ 768 821 EYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPC
LPQYPHINGSVKT -> RILTLTTNENFQSTSGREGTEIHA
LQCLRSEVTPAISCESPLADTGSKVPN (in isoform
9). {ECO:0000303|PubMed:10626794}.
/FTId=VSP_002980.
VAR_SEQ 769 821 YLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCL
PQYPHINGSVKT -> EKKVSGAVDCHKPPCNPSHLPCVLA
VDQ (in isoform 21).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_041915.
VAR_SEQ 778 821 QYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGS
VKT -> PYSPCYPDPR (in isoform 6).
{ECO:0000305}.
/FTId=VSP_002984.
VARIANT 6 6 R -> P (in dbSNP:rs3750819).
{ECO:0000269|Ref.15}.
/FTId=VAR_017258.
VARIANT 57 57 S -> L (polymorphism; dbSNP:rs56226109).
{ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:26429889}.
/FTId=VAR_042204.
VARIANT 105 105 Y -> C (in CS).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:8946174}.
/FTId=VAR_004112.
VARIANT 172 172 A -> F (in PS; requires 2 nucleotide
substitutions).
{ECO:0000269|PubMed:11781872}.
/FTId=VAR_017259.
VARIANT 186 186 M -> T (in dbSNP:rs755793).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:17344846,
ECO:0000269|Ref.15}.
/FTId=VAR_017260.
VARIANT 203 203 R -> C (in breast cancer samples;
infiltrating ductal carcinoma; somatic
mutation). {ECO:0000269|PubMed:16959974,
ECO:0000269|PubMed:17344846}.
/FTId=VAR_036380.
VARIANT 252 253 SP -> FS (in PS; dbSNP:rs281865420).
/FTId=VAR_004116.
VARIANT 252 252 S -> F (in APRS; requires 2 nucleotide
substitutions; dbSNP:rs121918498).
{ECO:0000269|PubMed:9002682}.
/FTId=VAR_004114.
VARIANT 252 252 S -> L (in CS; dbSNP:rs79184941).
{ECO:0000269|PubMed:9002682}.
/FTId=VAR_004113.
VARIANT 252 252 S -> W (in APRS and PS; common mutation;
dbSNP:rs79184941).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:15190072,
ECO:0000269|PubMed:7668257,
ECO:0000269|PubMed:7719344,
ECO:0000269|PubMed:9452027,
ECO:0000269|PubMed:9677057,
ECO:0000269|PubMed:9719378}.
/FTId=VAR_004115.
VARIANT 253 253 P -> R (in APRS; common mutation;
dbSNP:rs77543610).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:7668257,
ECO:0000269|PubMed:7719344,
ECO:0000269|PubMed:9452027,
ECO:0000269|PubMed:9677057}.
/FTId=VAR_004117.
VARIANT 263 263 P -> L (in CS; dbSNP:rs779326224).
{ECO:0000269|PubMed:11173845}.
/FTId=VAR_017261.
VARIANT 267 267 S -> P (in CS; dbSNP:rs121918505).
{ECO:0000269|PubMed:11781872}.
/FTId=VAR_004118.
VARIANT 268 268 T -> TG (in CS).
{ECO:0000269|PubMed:8644708}.
/FTId=VAR_004119.
VARIANT 269 270 Missing (in SCS).
{ECO:0000269|PubMed:9585583}.
/FTId=VAR_075856.
VARIANT 272 272 G -> V (in an ovarian serous carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_042205.
VARIANT 273 273 Missing (in PS; type 2).
{ECO:0000269|PubMed:10945669}.
/FTId=VAR_017262.
VARIANT 276 276 F -> V (in CS).
{ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:9521581}.
/FTId=VAR_004120.
VARIANT 278 278 C -> F (in CS, JWS and PS; forms
disulfide-linked dimers with constitutive
kinase activity, is retained in an
intracellular compartment and not
detected at the cell surface;
dbSNP:rs776587763).
{ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:16844695,
ECO:0000269|PubMed:8644708,
ECO:0000269|PubMed:9677057}.
/FTId=VAR_004121.
VARIANT 278 278 C -> Y (in CS).
{ECO:0000269|PubMed:11173845}.
/FTId=VAR_017263.
VARIANT 281 281 Y -> C (in CS).
{ECO:0000269|PubMed:11380921,
ECO:0000269|PubMed:11781872}.
/FTId=VAR_017264.
VARIANT 283 283 D -> N (in a lung squamous cell carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_042206.
VARIANT 287 289 Missing (in CS).
/FTId=VAR_004122.
VARIANT 288 288 I -> S (in CS).
{ECO:0000269|PubMed:11173845}.
/FTId=VAR_017265.
VARIANT 289 289 Q -> P (in CS and JWS;
dbSNP:rs121918497).
{ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:11380921,
ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:7581378,
ECO:0000269|PubMed:8644708}.
/FTId=VAR_004123.
VARIANT 290 290 W -> C (in PS; severe; also in a lung
squamous cell carcinoma sample; somatic
mutation; dbSNP:rs121918499).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:9150725}.
/FTId=VAR_004124.
VARIANT 290 290 W -> G (in CS; dbSNP:rs121918501).
{ECO:0000269|PubMed:8528214}.
/FTId=VAR_017266.
VARIANT 290 290 W -> R (in CS; dbSNP:rs121918501).
/FTId=VAR_004125.
VARIANT 292 292 K -> E (in CS; dbSNP:rs121918500).
{ECO:0000269|PubMed:9152842}.
/FTId=VAR_004126.
VARIANT 301 301 Y -> C (in CS).
{ECO:0000269|PubMed:9521581}.
/FTId=VAR_004127.
VARIANT 314 314 A -> S (in craniosynostosis).
{ECO:0000269|PubMed:9521581}.
/FTId=VAR_004128.
VARIANT 315 315 A -> S (in a non-syndromic
craniosynostosis patient with abnormal
intrauterine history; confers
predisposition to craniosynostosis;
dbSNP:rs121918504).
{ECO:0000269|PubMed:10951518,
ECO:0000269|PubMed:11781872}.
/FTId=VAR_017267.
VARIANT 321 321 D -> A (in PS; dbSNP:rs121918510).
{ECO:0000269|PubMed:7719333}.
/FTId=VAR_004129.
VARIANT 328 328 Y -> C (in CS; dbSNP:rs121918493).
{ECO:0000269|PubMed:7874170}.
/FTId=VAR_004130.
VARIANT 331 331 N -> I (in CS).
{ECO:0000269|PubMed:8956050}.
/FTId=VAR_004131.
VARIANT 337 337 A -> ANA (in CS).
/FTId=VAR_004132.
VARIANT 337 337 A -> P (in CS; dbSNP:rs387906676).
{ECO:0000269|PubMed:9677057}.
/FTId=VAR_017268.
VARIANT 338 338 G -> E (in CS).
{ECO:0000269|PubMed:8946174}.
/FTId=VAR_004133.
VARIANT 338 338 G -> R (in CS).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:7581378,
ECO:0000269|PubMed:9677057}.
/FTId=VAR_015011.
VARIANT 340 340 Y -> C (in PS).
{ECO:0000269|PubMed:10394936,
ECO:0000269|PubMed:11781872}.
/FTId=VAR_017269.
VARIANT 340 340 Y -> H (in CS; dbSNP:rs121918489).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:7987400}.
/FTId=VAR_004134.
VARIANT 341 341 T -> P (in PS and CS; dbSNP:rs121918495).
{ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:7719345}.
/FTId=VAR_004135.
VARIANT 342 342 C -> F (in CS).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:8644708,
ECO:0000269|PubMed:9677057}.
/FTId=VAR_004136.
VARIANT 342 342 C -> G (in PS).
{ECO:0000269|PubMed:10394936}.
/FTId=VAR_017270.
VARIANT 342 342 C -> R (in CS, JWS, PS and ABS2;
dbSNP:rs121918488).
{ECO:0000269|PubMed:10633130,
ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:11380921,
ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:7719345,
ECO:0000269|PubMed:7987400,
ECO:0000269|PubMed:8528214,
ECO:0000269|PubMed:8644708,
ECO:0000269|PubMed:9677057}.
/FTId=VAR_004137.
VARIANT 342 342 C -> S (in CS, JWS, PS and ABS2;
dbSNP:rs121918488).
{ECO:0000269|PubMed:10633130,
ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:7581378,
ECO:0000269|PubMed:7987400,
ECO:0000269|PubMed:8644708,
ECO:0000269|PubMed:9385368,
ECO:0000269|Ref.10}.
/FTId=VAR_004138.
VARIANT 342 342 C -> W (in CS; dbSNP:rs121918496).
{ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:8528214}.
/FTId=VAR_017271.
VARIANT 342 342 C -> Y (in CS and PS; dbSNP:rs121918487).
{ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:11380921,
ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:7581378,
ECO:0000269|PubMed:7719345,
ECO:0000269|PubMed:7987400,
ECO:0000269|PubMed:8644708,
ECO:0000269|PubMed:9677057}.
/FTId=VAR_004139.
VARIANT 344 344 A -> G (in CS and JWS;
dbSNP:rs121918492).
{ECO:0000269|PubMed:7581378,
ECO:0000269|PubMed:7874170}.
/FTId=VAR_004140.
VARIANT 344 344 A -> P (in CS and PS).
{ECO:0000269|PubMed:8644708}.
/FTId=VAR_004141.
VARIANT 347 347 S -> C (in CS; dbSNP:rs121918494).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:7874170}.
/FTId=VAR_004142.
VARIANT 351 351 S -> C (in CS, PS and ABS2;
dbSNP:rs121918502).
{ECO:0000269|PubMed:10633130,
ECO:0000269|PubMed:8946174,
ECO:0000269|PubMed:9693549}.
/FTId=VAR_004143.
VARIANT 354 354 S -> C (in CS; dbSNP:rs121918490).
{ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:7581378,
ECO:0000269|PubMed:7987400,
ECO:0000269|PubMed:8528214}.
/FTId=VAR_004144.
VARIANT 354 354 S -> Y (in CS).
{ECO:0000269|PubMed:11173845}.
/FTId=VAR_017272.
VARIANT 356 358 Missing (in CS).
{ECO:0000269|PubMed:8956050}.
/FTId=VAR_004145.
VARIANT 359 359 V -> F (in CS and PS).
{ECO:0000269|PubMed:11173845,
ECO:0000269|PubMed:8644708}.
/FTId=VAR_004146.
VARIANT 362 362 A -> S (in CS).
{ECO:0000269|PubMed:10574673}.
/FTId=VAR_017273.
VARIANT 372 372 S -> C (in BSTVS; dbSNP:rs121913477).
{ECO:0000269|PubMed:8696350}.
/FTId=VAR_017274.
VARIANT 375 375 Y -> C (in PS and BSTVS;
dbSNP:rs121913478).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:12000365,
ECO:0000269|PubMed:8696350}.
/FTId=VAR_017275.
VARIANT 381 381 Y -> D (in BBDS; dbSNP:rs387906678).
{ECO:0000269|PubMed:22387015}.
/FTId=VAR_067977.
VARIANT 384 384 G -> R (in CS).
{ECO:0000269|PubMed:8946174}.
/FTId=VAR_004147.
VARIANT 391 391 M -> R (in BBDS; the mutation selectively
reduces plasma-membrane levels of the
protein and markedly diminishes the
receptor's responsiveness to
extracellular FGF; dbSNP:rs387906677).
{ECO:0000269|PubMed:22387015}.
/FTId=VAR_067978.
VARIANT 526 526 K -> E (in FSPC; constitutive kinase
activity; dbSNP:rs121918507).
{ECO:0000269|PubMed:16061565,
ECO:0000269|PubMed:17803937}.
/FTId=VAR_023788.
VARIANT 549 549 N -> H (in CS; constitutive kinase
activity). {ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:17803937}.
/FTId=VAR_017276.
VARIANT 565 565 E -> G (in PS; constitutive kinase
activity). {ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:17803937}.
/FTId=VAR_017277.
VARIANT 612 612 R -> T (in a lung adenocarcinoma sample;
somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_046071.
VARIANT 613 613 G -> R. {ECO:0000269|PubMed:10626794,
ECO:0000269|PubMed:1309608}.
/FTId=VAR_015012.
VARIANT 628 628 A -> T (in LADDS; strongly reduced kinase
activity; dbSNP:rs121918509).
{ECO:0000269|PubMed:16501574}.
/FTId=VAR_029884.
VARIANT 641 641 K -> R (in PS; constitutive kinase
activity). {ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:17803937}.
/FTId=VAR_017278.
VARIANT 648 648 A -> T (in LADDS; dbSNP:rs121918508).
{ECO:0000269|PubMed:16501574}.
/FTId=VAR_029885.
VARIANT 649 650 RD -> S (in LADDS).
{ECO:0000269|PubMed:16501574}.
/FTId=VAR_029886.
VARIANT 659 659 K -> N (in craniosynostosis; constitutive
kinase activity).
{ECO:0000269|PubMed:11781872,
ECO:0000269|PubMed:17803937}.
/FTId=VAR_017279.
VARIANT 663 663 G -> E (in PS).
{ECO:0000269|PubMed:11781872}.
/FTId=VAR_017280.
VARIANT 678 678 R -> G (in CS).
{ECO:0000269|PubMed:11781872}.
/FTId=VAR_017281.
MUTAGEN 265 265 N->Q: Reduced N-glycosylation. Reduced
expression at the cell surface.
{ECO:0000269|PubMed:16844695}.
MUTAGEN 549 549 N->T: Constitutive kinase activity.
{ECO:0000269|PubMed:17803937}.
MUTAGEN 565 565 E->A: Constitutive kinase activity.
{ECO:0000269|PubMed:17803937}.
MUTAGEN 656 657 Missing: Loss of kinase activity.
{ECO:0000269|PubMed:16844695}.
MUTAGEN 769 769 Y->F: Increases fibroblast proliferation.
Decreases phosphorylation of PLCG1 and
FRS2. Decreases activation of MAP
kinases. {ECO:0000269|PubMed:15629145,
ECO:0000269|PubMed:19103595}.
CONFLICT 246 246 L -> P (in Ref. 16; BAG57383).
{ECO:0000305}.
CONFLICT 310 310 K -> N (in Ref. 16; BAG57383).
{ECO:0000305}.
STRAND 152 157 {ECO:0000244|PDB:3CAF}.
TURN 159 162 {ECO:0000244|PDB:3CAF}.
STRAND 166 170 {ECO:0000244|PDB:3CAF}.
STRAND 175 178 {ECO:0000244|PDB:3CAF}.
STRAND 181 185 {ECO:0000244|PDB:3CAF}.
STRAND 188 193 {ECO:0000244|PDB:3CAF}.
HELIX 200 202 {ECO:0000244|PDB:3CAF}.
STRAND 203 205 {ECO:0000244|PDB:4WV1}.
STRAND 208 210 {ECO:0000244|PDB:3CAF}.
HELIX 211 213 {ECO:0000244|PDB:3CAF}.
STRAND 215 218 {ECO:0000244|PDB:3CAF}.
HELIX 223 225 {ECO:0000244|PDB:3CAF}.
STRAND 227 235 {ECO:0000244|PDB:3CAF}.
STRAND 238 249 {ECO:0000244|PDB:3CAF}.
STRAND 266 269 {ECO:0000244|PDB:3OJM}.
STRAND 274 277 {ECO:0000244|PDB:3OJM}.
STRAND 287 293 {ECO:0000244|PDB:3OJM}.
STRAND 296 298 {ECO:0000244|PDB:3OJ2}.
STRAND 299 301 {ECO:0000244|PDB:3OJM}.
STRAND 303 305 {ECO:0000244|PDB:1IIL}.
STRAND 309 313 {ECO:0000244|PDB:3OJM}.
STRAND 315 319 {ECO:0000244|PDB:2FDB}.
TURN 321 325 {ECO:0000244|PDB:1EV2}.
STRAND 326 329 {ECO:0000244|PDB:1EV2}.
HELIX 334 336 {ECO:0000244|PDB:1EV2}.
STRAND 338 345 {ECO:0000244|PDB:1EV2}.
STRAND 350 357 {ECO:0000244|PDB:1EV2}.
TURN 463 465 {ECO:0000244|PDB:5UI0}.
TURN 472 474 {ECO:0000244|PDB:2PVF}.
HELIX 478 480 {ECO:0000244|PDB:2PVF}.
STRAND 481 489 {ECO:0000244|PDB:2PVF}.
STRAND 494 500 {ECO:0000244|PDB:2PVF}.
STRAND 504 506 {ECO:0000244|PDB:3CLY}.
STRAND 513 518 {ECO:0000244|PDB:2PVF}.
HELIX 525 541 {ECO:0000244|PDB:2PVF}.
STRAND 550 554 {ECO:0000244|PDB:2PVF}.
STRAND 556 558 {ECO:0000244|PDB:2PVF}.
STRAND 561 565 {ECO:0000244|PDB:2PVF}.
STRAND 568 571 {ECO:0000244|PDB:1OEC}.
HELIX 572 577 {ECO:0000244|PDB:2PVF}.
TURN 585 588 {ECO:0000244|PDB:4J99}.
HELIX 594 596 {ECO:0000244|PDB:5UI0}.
HELIX 600 619 {ECO:0000244|PDB:2PVF}.
HELIX 629 631 {ECO:0000244|PDB:2PVF}.
STRAND 632 634 {ECO:0000244|PDB:2PVF}.
TURN 636 638 {ECO:0000244|PDB:2PVY}.
STRAND 640 642 {ECO:0000244|PDB:2PVF}.
HELIX 645 647 {ECO:0000244|PDB:5UGL}.
TURN 652 654 {ECO:0000244|PDB:2PVF}.
STRAND 655 658 {ECO:0000244|PDB:2PVF}.
TURN 659 662 {ECO:0000244|PDB:2PZR}.
STRAND 664 666 {ECO:0000244|PDB:5UI0}.
HELIX 667 669 {ECO:0000244|PDB:2PVF}.
HELIX 672 677 {ECO:0000244|PDB:2PVF}.
HELIX 682 697 {ECO:0000244|PDB:2PVF}.
HELIX 709 718 {ECO:0000244|PDB:2PVF}.
STRAND 726 728 {ECO:0000244|PDB:2PZ5}.
HELIX 730 739 {ECO:0000244|PDB:2PVF}.
HELIX 744 746 {ECO:0000244|PDB:2PVF}.
HELIX 750 764 {ECO:0000244|PDB:2PVF}.
SEQUENCE 821 AA; 92025 MW; 6CD5001C960ED82F CRC64;
MVSWGRFICL VVVTMATLSL ARPSFSLVED TTLEPEEPPT KYQISQPEVY VAAPGESLEV
RCLLKDAAVI SWTKDGVHLG PNNRTVLIGE YLQIKGATPR DSGLYACTAS RTVDSETWYF
MVNVTDAISS GDDEDDTDGA EDFVSENSNN KRAPYWTNTE KMEKRLHAVP AANTVKFRCP
AGGNPMPTMR WLKNGKEFKQ EHRIGGYKVR NQHWSLIMES VVPSDKGNYT CVVENEYGSI
NHTYHLDVVE RSPHRPILQA GLPANASTVV GGDVEFVCKV YSDAQPHIQW IKHVEKNGSK
YGPDGLPYLK VLKAAGVNTT DKEIEVLYIR NVTFEDAGEY TCLAGNSIGI SFHSAWLTVL
PAPGREKEIT ASPDYLEIAI YCIGVFLIAC MVVTVILCRM KNTTKKPDFS SQPAVHKLTK
RIPLRRQVTV SAESSSSMNS NTPLVRITTR LSSTADTPML AGVSEYELPE DPKWEFPRDK
LTLGKPLGEG CFGQVVMAEA VGIDKDKPKE AVTVAVKMLK DDATEKDLSD LVSEMEMMKM
IGKHKNIINL LGACTQDGPL YVIVEYASKG NLREYLRARR PPGMEYSYDI NRVPEEQMTF
KDLVSCTYQL ARGMEYLASQ KCIHRDLAAR NVLVTENNVM KIADFGLARD INNIDYYKKT
TNGRLPVKWM APEALFDRVY THQSDVWSFG VLMWEIFTLG GSPYPGIPVE ELFKLLKEGH
RMDKPANCTN ELYMMMRDCW HAVPSQRPTF KQLVEDLDRI LTLTTNEEYL DLSQPLEQYS
PSYPDTRSSC SSGDDSVFSP DPMPYEPCLP QYPHINGSVK T


Related products :

Catalog number Product name Quantity
18-272-195177 FGFR2 - Rabbit polyclonal to FGFR2; EC 2.7.10.1; FGFR-2; Keratinocyte growth factor receptor 2; CD332 antigen Polyclonal 0.05 ml
18-272-195176 FGFR2 - Rabbit polyclonal to FGFR2; EC 2.7.10.1; FGFR-2; Keratinocyte growth factor receptor 2; CD332 antigen Polyclonal 0.1 ml
E0074r ELISA Basic fibroblast growth factor receptor 1,bFGF-R-1,Fgfr1,FGFR-1,Fibroblast growth factor receptor 1,Flg,MFR,Proto-oncogene c-Fgr,Rat,Rattus norvegicus 96T
E0074m ELISA Basic fibroblast growth factor receptor 1,bFGF-R-1,Fgfr1,FGFR-1,Fibroblast growth factor receptor 1,Flg,MFR,Mouse,Mus musculus,Proto-oncogene c-Fgr 96T
U0074r CLIA Basic fibroblast growth factor receptor 1,bFGF-R-1,Fgfr1,FGFR-1,Fibroblast growth factor receptor 1,Flg,MFR,Proto-oncogene c-Fgr,Rat,Rattus norvegicus 96T
U0074m CLIA Basic fibroblast growth factor receptor 1,bFGF-R-1,Fgfr1,FGFR-1,Fibroblast growth factor receptor 1,Flg,MFR,Mouse,Mus musculus,Proto-oncogene c-Fgr 96T
E0074m ELISA kit Basic fibroblast growth factor receptor 1,bFGF-R-1,Fgfr1,FGFR-1,Fibroblast growth factor receptor 1,Flg,MFR,Mouse,Mus musculus,Proto-oncogene c-Fgr 96T
E0074r ELISA kit Basic fibroblast growth factor receptor 1,bFGF-R-1,Fgfr1,FGFR-1,Fibroblast growth factor receptor 1,Flg,MFR,Proto-oncogene c-Fgr,Rat,Rattus norvegicus 96T
U0074h CLIA Basic fibroblast growth factor receptor 1,BFGFR,BFGFR,bFGF-R-1,CEK,FGFBR,FGFR1,FGFR-1,Fibroblast growth factor receptor 1,FLG,FLT2,FLT-2,Fms-like tyrosine kinase 2,HBGFR,Homo sapiens,Human,N-sam, 96T
E0074h ELISA Basic fibroblast growth factor receptor 1,BFGFR,BFGFR,bFGF-R-1,CEK,FGFBR,FGFR1,FGFR-1,Fibroblast growth factor receptor 1,FLG,FLT2,FLT-2,Fms-like tyrosine kinase 2,HBGFR,Homo sapiens,Human,N-sam 96T
E0074h ELISA kit Basic fibroblast growth factor receptor 1,BFGFR,BFGFR,bFGF-R-1,CEK,FGFBR,FGFR1,FGFR-1,Fibroblast growth factor receptor 1,FLG,FLT2,FLT-2,Fms-like tyrosine kinase 2,HBGFR,Homo sapiens,Human, 96T
U0074c CLIA Basic fibroblast growth factor receptor 1,bFGF-R-1,CEK1,Chicken,FGFR1,FGFR-1,Fibroblast growth factor receptor 1,Gallus gallus,Tyrosine kinase receptor CEK1 96T
E0074c ELISA kit Basic fibroblast growth factor receptor 1,bFGF-R-1,CEK1,Chicken,FGFR1,FGFR-1,Fibroblast growth factor receptor 1,Gallus gallus,Tyrosine kinase receptor CEK1 96T
E0074c ELISA Basic fibroblast growth factor receptor 1,bFGF-R-1,CEK1,Chicken,FGFR1,FGFR-1,Fibroblast growth factor receptor 1,Gallus gallus,Tyrosine kinase receptor CEK1 96T
10-664-50009 Fibroblast growth factor receptor 3 - EC 2.7.10.1; FGFR-3; CD333 antigen N_A 0.1 mg
E0636h ELISA kit FGF7,FGF-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Homo sapiens,Human,Keratinocyte growth factor,KGF,KGF 96T
U0636h CLIA FGF7,FGF-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Homo sapiens,Human,Keratinocyte growth factor,KGF,KGF 96T
E0636h ELISA FGF7,FGF-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Homo sapiens,Human,Keratinocyte growth factor,KGF,KGF 96T
U0636r CLIA Fgf7,FGF-7,Fgf-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Kgf,Rat,Rattus norvegicus 96T
U0636m CLIA Fgf7,FGF-7,Fgf-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Mouse,Mus musculus 96T
E0636r ELISA Fgf7,FGF-7,Fgf-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Kgf,Rat,Rattus norvegicus 96T
E0636r ELISA kit Fgf7,FGF-7,Fgf-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Kgf,Rat,Rattus norvegicus 96T
E0636m ELISA Fgf7,FGF-7,Fgf-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Mouse,Mus musculus 96T
E0636m ELISA kit Fgf7,FGF-7,Fgf-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Mouse,Mus musculus 96T
E0636p ELISA FGF7,FGF-7,Fibroblast growth factor 7,HBGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,KGF,Pig,Sus scrofa 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur