Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Galactose-3-O-sulfotransferase 4 (Gal3ST-4) (EC 2.8.2.-) (Beta-galactose-3-O-sulfotransferase 4) (Gal-beta-1,3-GalNAc 3'-sulfotransferase)

 G3ST4_HUMAN             Reviewed;         486 AA.
Q96RP7; A4D2A8; B4DWL8; D6W5U5; Q8N3P7; Q8WZ17; Q96E33; Q9HA78;
10-MAY-2004, integrated into UniProtKB/Swiss-Prot.
01-DEC-2001, sequence version 1.
27-SEP-2017, entry version 127.
RecName: Full=Galactose-3-O-sulfotransferase 4;
Short=Gal3ST-4;
EC=2.8.2.-;
AltName: Full=Beta-galactose-3-O-sulfotransferase 4;
AltName: Full=Gal-beta-1,3-GalNAc 3'-sulfotransferase;
Name=GAL3ST4; ORFNames=PP6968;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, AND TISSUE
SPECIFICITY.
TISSUE=Testis;
PubMed=11333265; DOI=10.1074/jbc.M101558200;
Seko A., Hara-Kuge S., Yamashita K.;
"Molecular cloning and characterization of a novel human galactose 3-
O-sulfotransferase that transfers sulfate to Galbeta1->3GalNAc residue
in O-glycans.";
J. Biol. Chem. 276:25697-25704(2001).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
VAL-467.
PubMed=15498874; DOI=10.1073/pnas.0404089101;
Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H.,
Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y.,
Shu H., Chen X., Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S.,
Gu J.;
"Large-scale cDNA transfection screening for genes related to cancer
development and progression.";
Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Mammary gland;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Amygdala;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12853948; DOI=10.1038/nature01782;
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H.,
Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R.,
Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E.,
Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H.,
Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A.,
Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J.,
Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A.,
Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S.,
Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M.,
Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C.,
Latreille P., Miller N., Johnson D., Murray J., Woessner J.P.,
Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J.,
Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L.,
Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R.,
Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E.,
Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K.,
Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S.,
Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M.,
Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R.,
Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D.,
Waterston R.H., Wilson R.K.;
"The DNA sequence of human chromosome 7.";
Nature 424:157-164(2003).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12690205; DOI=10.1126/science.1083423;
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K.,
Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R.,
Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A.,
Kanematsu E., Gentles S., Christopoulos C.C., Choufani S.,
Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z.,
Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C.,
Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J.,
Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F.,
Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F.,
Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H.,
Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G.,
Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P.,
Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J.,
Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F.,
Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B.,
Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H.,
Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W.,
Mural R.J., Adams M.D., Tsui L.-C.;
"Human chromosome 7: DNA sequence and biology.";
Science 300:767-772(2003).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
VAL-467.
TISSUE=Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: Catalyzes the transfer of sulfate to beta-1,3-linked
galactose residues in O-linked glycoproteins. Good substrates
include asialofetuin, Gal-beta-1,3-GalNAc and Gal-beta-1,3
(GlcNAc-beta-1,6)GalNAc. {ECO:0000269|PubMed:11333265}.
-!- COFACTOR:
Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
-!- BIOPHYSICOCHEMICAL PROPERTIES:
pH dependence:
Optimum pH is 6-7.;
-!- PATHWAY: Protein modification; carbohydrate sulfation.
-!- SUBCELLULAR LOCATION: Golgi apparatus, Golgi stack membrane
{ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q96RP7-1; Sequence=Displayed;
Name=2;
IsoId=Q96RP7-2; Sequence=VSP_057006, VSP_057007;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed mainly in placenta, thymus, testis,
ovary, spinal cord, trachea and adrenal gland and at low levels in
brain, lung, spleen, prostate, small intestine, colon, stomach
thyroid and lymph node. {ECO:0000269|PubMed:11333265}.
-!- SIMILARITY: Belongs to the galactose-3-O-sulfotransferase family.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF316113; AAK73365.1; -; mRNA.
EMBL; AF289575; AAL55759.1; -; mRNA.
EMBL; AK022178; BAB13977.1; -; mRNA.
EMBL; AK301591; BAG63080.1; -; mRNA.
EMBL; AL833824; CAD38686.2; -; mRNA.
EMBL; AC073842; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH236956; EAL23847.1; -; Genomic_DNA.
EMBL; CH471091; EAW76575.1; -; Genomic_DNA.
EMBL; CH471091; EAW76577.1; -; Genomic_DNA.
EMBL; CH471091; EAW76579.1; -; Genomic_DNA.
EMBL; BC012976; AAH12976.1; -; mRNA.
CCDS; CCDS5688.1; -. [Q96RP7-1]
RefSeq; NP_078913.3; NM_024637.4. [Q96RP7-1]
UniGene; Hs.44856; -.
ProteinModelPortal; Q96RP7; -.
SMR; Q96RP7; -.
BioGrid; 122811; 1.
IntAct; Q96RP7; 1.
STRING; 9606.ENSP00000353142; -.
iPTMnet; Q96RP7; -.
PhosphoSitePlus; Q96RP7; -.
BioMuta; GAL3ST4; -.
DMDM; 47116570; -.
PaxDb; Q96RP7; -.
PeptideAtlas; Q96RP7; -.
PRIDE; Q96RP7; -.
Ensembl; ENST00000360039; ENSP00000353142; ENSG00000197093. [Q96RP7-1]
Ensembl; ENST00000413800; ENSP00000400451; ENSG00000197093. [Q96RP7-1]
GeneID; 79690; -.
KEGG; hsa:79690; -.
UCSC; uc003utt.4; human. [Q96RP7-1]
CTD; 79690; -.
DisGeNET; 79690; -.
EuPathDB; HostDB:ENSG00000197093.10; -.
GeneCards; GAL3ST4; -.
HGNC; HGNC:24145; GAL3ST4.
HPA; HPA038137; -.
HPA; HPA038138; -.
MIM; 608235; gene.
neXtProt; NX_Q96RP7; -.
OpenTargets; ENSG00000197093; -.
PharmGKB; PA134921067; -.
eggNOG; ENOG410IG5S; Eukaryota.
eggNOG; ENOG4110RXY; LUCA.
GeneTree; ENSGT00390000013505; -.
HOGENOM; HOG000232148; -.
HOVERGEN; HBG051681; -.
InParanoid; Q96RP7; -.
KO; K09677; -.
OMA; DSFFFSI; -.
OrthoDB; EOG091G0N28; -.
PhylomeDB; Q96RP7; -.
TreeFam; TF314802; -.
UniPathway; UPA00353; -.
GeneWiki; GAL3ST4; -.
GenomeRNAi; 79690; -.
PRO; PR:Q96RP7; -.
Proteomes; UP000005640; Chromosome 7.
Bgee; ENSG00000197093; -.
CleanEx; HS_GAL3ST4; -.
ExpressionAtlas; Q96RP7; baseline and differential.
Genevisible; Q96RP7; HS.
GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB.
GO; GO:0032580; C:Golgi cisterna membrane; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; NAS:UniProtKB.
GO; GO:0016020; C:membrane; IDA:UniProtKB.
GO; GO:0050656; F:3'-phosphoadenosine 5'-phosphosulfate binding; NAS:UniProtKB.
GO; GO:0050694; F:galactose 3-O-sulfotransferase activity; IDA:UniProtKB.
GO; GO:0001733; F:galactosylceramide sulfotransferase activity; IEA:InterPro.
GO; GO:0050698; F:proteoglycan sulfotransferase activity; NAS:UniProtKB.
GO; GO:0007267; P:cell-cell signaling; NAS:UniProtKB.
GO; GO:0009247; P:glycolipid biosynthetic process; IEA:InterPro.
GO; GO:0009100; P:glycoprotein metabolic process; NAS:UniProtKB.
GO; GO:0009311; P:oligosaccharide metabolic process; NAS:UniProtKB.
GO; GO:0030166; P:proteoglycan biosynthetic process; NAS:UniProtKB.
GO; GO:0006790; P:sulfur compound metabolic process; NAS:UniProtKB.
InterPro; IPR009729; Gal-3-0_sulfotransfrase.
InterPro; IPR027417; P-loop_NTPase.
PANTHER; PTHR14647; PTHR14647; 1.
Pfam; PF06990; Gal-3-0_sulfotr; 2.
SUPFAM; SSF52540; SSF52540; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Glycoprotein;
Golgi apparatus; Membrane; Polymorphism; Reference proteome;
Signal-anchor; Transferase; Transmembrane; Transmembrane helix.
CHAIN 1 486 Galactose-3-O-sulfotransferase 4.
/FTId=PRO_0000085209.
TOPO_DOM 1 18 Cytoplasmic. {ECO:0000255}.
TRANSMEM 19 39 Helical; Signal-anchor for type II
membrane protein. {ECO:0000255}.
TOPO_DOM 40 486 Lumenal. {ECO:0000255}.
CARBOHYD 374 374 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 80 MGPLSPARTLRLWGPRSLGVALGVFMTIGFALQLLGGPFQR
RLPGLQLRQPSAPSLRPALPSCPPRQRLVFLKTHKSGSS
-> MTPRSPTSAFRSCTAVSSCLCPSSWPWLHLSVTSPFPV
PHGPSLSCQDAAALGTSEPGGGSGSLHDHWLCTPALGRALP
E (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_057006.
VAR_SEQ 81 142 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_057007.
VARIANT 353 353 R -> Q (in dbSNP:rs3800952).
/FTId=VAR_021989.
VARIANT 467 467 A -> V (in dbSNP:rs3823646).
{ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:15498874}.
/FTId=VAR_033736.
CONFLICT 137 137 M -> L (in Ref. 3; BAB13977).
{ECO:0000305}.
CONFLICT 201 204 RGDH -> VGTT (in Ref. 2; AAL55759).
{ECO:0000305}.
CONFLICT 441 441 S -> R (in Ref. 3; BAB13977).
{ECO:0000305}.
SEQUENCE 486 AA; 54166 MW; 2D731D16B191CC3C CRC64;
MGPLSPARTL RLWGPRSLGV ALGVFMTIGF ALQLLGGPFQ RRLPGLQLRQ PSAPSLRPAL
PSCPPRQRLV FLKTHKSGSS SVLSLLHRYG DQHGLRFALP ARYQFGYPKL FQASRVKGYR
PQGGGTQLPF HILCHHMRFN LKEVLQVMPS DSFFFSIVRD PAALARSAFS YYKSTSSAFR
KSPSLAAFLA NPRGFYRPGA RGDHYARNLL WFDFGLPFPP EKRAKRGNIH PPRDPNPPQL
QVLPSGAGPR AQTLNPNALI HPVSTVTDHR SQISSPASFD LGSSSFIQWG LAWLDSVFDL
VMVAEYFDES LVLLADALCW GLDDVVGFMH NAQAGHKQGL STVSNSGLTA EDRQLTARAR
AWNNLDWALY VHFNRSLWAR IEKYGQGRLQ TAVAELRARR EALAKHCLVG GEASDPKYIT
DRRFRPFQFG SAKVLGYILR SGLSPQDQEE CERLATPELQ YKDKLDAKQF PPTVSLPLKT
SRPLSP


Related products :

Catalog number Product name Quantity
EIAAB07287 Carbohydrate sulfotransferase 9,CHST9,GalNAc-4-O-sulfotransferase 2,GalNAc-4-ST2,GalNAc4ST-2,Homo sapiens,Human,N-acetylgalactosamine-4-O-sulfotransferase 2,UNQ2549_PRO6175
EIAAB07286 Carbohydrate sulfotransferase 8,CHST8,GalNAc-4-O-sulfotransferase 1,GalNAc-4-ST1,GalNAc4ST-1,Homo sapiens,Human,N-acetylgalactosamine-4-O-sulfotransferase 1
EIAAB07285 Carbohydrate sulfotransferase 8,Chst8,GalNAc-4-O-sulfotransferase 1,GalNAc-4-ST1,GalNAc4ST-1,Mouse,Mus musculus,N-acetylgalactosamine-4-O-sulfotransferase 1
EIAAB07288 Carbohydrate sulfotransferase 9,Chst9,GalNAc-4-O-sulfotransferase 2,GalNAc-4-ST2,GalNAc4ST-2,Mouse,Mus musculus,N-acetylgalactosamine-4-O-sulfotransferase 2
EIAAB40145 Alcohol sulfotransferase,Hydroxysteroid sulfotransferase 2,Rat,Rattus norvegicus,ST2B1,Sulfotransferase 2B1,Sulfotransferase family cytosolic 2B member 1,Sult2b1
EIAAB40146 Alcohol sulfotransferase,Hydroxysteroid sulfotransferase 2,Mouse,Mus musculus,ST2B1,Sulfotransferase 2B1,Sulfotransferase family cytosolic 2B member 1,Sult2b,Sult2b1
EIAAB40140 Bile salt sulfotransferase,Dehydroepiandrosterone sulfotransferase,DHEA-ST,Homo sapiens,HST,HST,Human,Hydroxysteroid Sulfotransferase,ST2,ST2A1,ST2A3,STD,Sulfotransferase 2A1,SULT2A1
EIAAB40144 Alcohol sulfotransferase,Homo sapiens,HSST2,Human,Hydroxysteroid sulfotransferase 2,ST2B1,Sulfotransferase 2B1,Sulfotransferase family cytosolic 2B member 1,SULT2B1
EIAAB40115 Aryl sulfotransferase,Aryl sulfotransferase IV,ASTIV,Minoxidil sulfotransferase,Mx-ST,Phenol sulfotransferase,PST-1,Rat,Rattus norvegicus,ST1A1,St1a1,Sulfokinase,Sulfotransferase 1A1,Sult1a1,Tyrosine-
30-578 GAL3ST3 is a member of the galactose-3-O-sulfotransferase protein family. It catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 0.05 mg
26-481 GAL3ST3 is a member of the galactose-3-O-sulfotransferase protein family. It catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 0.05 mg
EIAAB40112 Aryl sulfotransferase,Mouse,mSTp1,Mus musculus,Phenol sulfotransferase,Phenol_aryl sulfotransferase,ST1A1,St1a1,ST1A4,Stp,Stp1,Sulfokinase,Sulfotransferase 1A1,Sult1a1
EIAAB40120 Homo sapiens,Human,ST1B1,ST1B2,ST1B2,Sulfotransferase 1B1,Sulfotransferase 1B2,Sulfotransferase family cytosolic 1B member 1,SULT1B1,SULT1B2,Thyroid hormone sulfotransferase
EIAAB07297 C4ST2,C4ST-2,Carbohydrate sulfotransferase 12,Chondroitin 4-O-sulfotransferase 2,Chondroitin 4-sulfotransferase 2,CHST12,Homo sapiens,Human,Sulfotransferase Hlo,UNQ500_PRO1017
EIAAB40133 EST-1,Estrogen sulfotransferase, isoform 1,Estrone sulfotransferase,Rat,Rattus norvegicus,ST1E1,Ste,Ste1,Sulfotransferase 1E1,Sulfotransferase, estrogen-preferring,Sult1e1
EIAAB07274 C6ST-1,Carbohydrate sulfotransferase 3,Chondroitin 6-O-sulfotransferase 1,Chondroitin 6-sulfotransferase,CHST3,Galactose_N-acetylglucosamine_N-acetylglucosamine 6-O-sulfotransferase 0,GST-0,Homo sapie
EIAAB07281 Carbohydrate sulfotransferase 6,C-GlcNAc6ST,CHST6,Corneal N-acetylglucosamine-6-O-sulfotransferase,Galactose_N-acetylglucosamine_N-acetylglucosamine 6-O-sulfotransferase 4-beta,GlcNAc6ST-5,Gn6st-5,GST
26-502 B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is f 0.05 mg
EIAAB40114 Aryl sulfotransferase 1,HAST1_HAST2,Homo sapiens,Human,OK_SW-cl.88,Phenol sulfotransferase 1,Phenol-sulfating phenol sulfotransferase 1,P-PST 1,ST1A1,ST1A3,STP,STP1,Sulfotransferase 1A1,SULT1A1,Thermo
EIAAB40116 Aryl sulfotransferase 2,Homo sapiens,Human,Phenol sulfotransferase 2,Phenol-sulfating phenol sulfotransferase 2,P-PST 2,ST1A2,STP2,Sulfotransferase 1A2,SULT1A2
EIAAB40117 Aryl sulfotransferase 1A3_1A4,Catecholamine-sulfating phenol sulfotransferase,HAST3,Homo sapiens,Human,Monoamine-sulfating phenol sulfotransferase,M-PST,Placental estrogen sulfotransferase,ST1A3_ST1A4
EIAAB40119 DOPA_tyrosine sulfotransferase,Mouse,Mus musculus,ST1B1,Sulfotransferase 1B1,Sulfotransferase family cytosolic 1B member 1,Sult1b1
EIAAB40141 Bile salt sulfotransferase 1,Hydroxysteroid sulfotransferase,Mouse,Mus musculus,ST,ST2A1,Sta1,Sulfotransferase 2A1,Sult2a1
18-003-44263 Carbohydrate sulfotransferase 7 - EC 2.8.2.17; EC 2.8.2.-; Chondroitin 6-sulfotransferase 2; C6ST-2; N-acetylglucosamine 6-O-sulfotransferase 1; GlcNAc6ST-4; Galactose_N-acetylglucosamine_N-acetylgluc 0.1 mg Protein A
EIAAB40111 Aryl sulfotransferase,Bos taurus,Bovine,Phenol sulfotransferase,Phenol-sulfating phenol sulfotransferase,P-PST,ST1A1,STP,Sulfotransferase 1A1,SULT1A1


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur