Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Gastrin/cholecystokinin type B receptor (CCK-B receptor) (CCK-BR) (Cholecystokinin-2 receptor) (CCK2-R)

 GASR_HUMAN              Reviewed;         447 AA.
P32239; A8K7P9; O75824; Q16144; Q92492; Q96LC6; Q9NYK7; Q9UBV1;
01-OCT-1993, integrated into UniProtKB/Swiss-Prot.
01-OCT-1993, sequence version 1.
18-JUL-2018, entry version 186.
RecName: Full=Gastrin/cholecystokinin type B receptor;
Short=CCK-B receptor;
Short=CCK-BR;
AltName: Full=Cholecystokinin-2 receptor;
Short=CCK2-R;
Name=CCKBR; Synonyms=CCKRB;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=1280419; DOI=10.1016/0006-291X(92)91557-7;
Pisegna J.R., de Weerth A., Huppi K., Wank S.A.;
"Molecular cloning of the human brain and gastric cholecystokinin
receptor: structure, functional expression and chromosomal
localization.";
Biochem. Biophys. Res. Commun. 189:296-303(1992).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=7681836;
Lee Y.-M., Beinborn M., McBride E.W., Lu M., Kolakowski L.F. Jr.,
Kopin A.S.;
"The human brain cholecystokinin-B/gastrin receptor. Cloning and
characterization.";
J. Biol. Chem. 268:8164-8169(1993).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, AND TISSUE
SPECIFICITY.
TISSUE=Brain;
PubMed=8349705;
Ito M., Matsui T., Taniguchi T., Tsukamoto T., Murayama T., Arima N.,
Nakata H., Chiba T., Chihara K.;
"Functional characterization of a human brain cholecystokinin-B
receptor. A trophic effect of cholecystokinin and gastrin.";
J. Biol. Chem. 268:18300-18305(1993).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
TISSUE=Placenta;
PubMed=8415658; DOI=10.1073/pnas.90.19.9085;
Song I., Brown D.R., Wiltshire R.N., Gantz I., Trent J.M., Yamada T.;
"The human gastrin/cholecystokinin type B receptor gene: alternative
splice donor site in exon 4 generates two variant mRNAs.";
Proc. Natl. Acad. Sci. U.S.A. 90:9085-9089(1993).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, AND TISSUE
SPECIFICITY.
TISSUE=Fetal brain;
PubMed=8185170; DOI=10.1111/j.1749-6632.1994.tb44076.x;
Herget T., Sethi T., Wu S.V., Walsh J.H., Rozengurt E.;
"Cholecystokinin stimulates Ca2+ mobilization and clonal growth in
small cell lung cancer through CCKA and CCKB/gastrin receptors.";
Ann. N. Y. Acad. Sci. 713:283-297(1994).
[6]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, ALTERNATIVE SPLICING, AND
TISSUE SPECIFICITY.
TISSUE=Lung fibroblast;
PubMed=7848914;
Ito M., Iwata N., Taniguchi T., Murayama T., Chihara K., Matsui T.;
"Functional characterization of two cholecystokinin-B/gastrin receptor
isoforms: a preferential splice donor site in the human receptor
gene.";
Cell Growth Differ. 5:1127-1135(1994).
[7]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), AND TISSUE SPECIFICITY.
TISSUE=Stomach;
PubMed=7887934; DOI=10.1006/bbrc.1995.1328;
Miyake A.;
"A truncated isoform of human CCK-B/gastrin receptor generated by
alternative usage of a novel exon.";
Biochem. Biophys. Res. Commun. 208:230-237(1995).
[8]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION (ISOFORM 2), AND
TISSUE SPECIFICITY.
TISSUE=Colon cancer;
PubMed=10913157; DOI=10.1074/jbc.M005754200;
Hellmich M.R., Rui X.-L., Hellmich H.L., Fleming R.Y.D., Evers B.M.,
Townsend C.M. Jr.;
"Human colorectal cancers express a constitutively active
cholecystokinin-B/gastrin receptor that stimulates cell growth.";
J. Biol. Chem. 275:32122-32128(2000).
[9]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, AND ALTERNATIVE
SPLICING.
TISSUE=Peripheral blood;
PubMed=11495676; DOI=10.1016/S0167-0115(01)00281-6;
Schmitz F., Schrader H., Otte J.-M., Schmitz H., Stueber E.,
Herzig K.-H., Schmidt W.E.;
"Identification of CCK-B/gastrin receptor splice variants in human
peripheral blood mononuclear cells.";
Regul. Pept. 101:25-33(2001).
[10]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND TISSUE SPECIFICITY.
TISSUE=Pancreatic cancer;
PubMed=12429993;
Smith J.P., Verderame M.F., McLaughlin P., Martenis M., Ballard E.,
Zagon I.S.;
"Characterization of the CCK-C (cancer) receptor in human pancreatic
cancer.";
Int. J. Mol. Med. 10:689-694(2002).
[11]
NUCLEOTIDE SEQUENCE [MRNA].
TISSUE=Temporal cortex;
Tate S.N., Gray J., Denyer J., Stolz M., Foord S., Lee M.G.;
"Cloning and expression of the human temporal cortex cholecystokinin B
receptor.";
Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases.
[12]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Stomach;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[13]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
Kopatz S.A., Aronstam R.S., Sharma S.V.;
"cDNA clones of human proteins involved in signal transduction
sequenced by the Guthrie cDNA resource center (www.cdna.org).";
Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases.
[14]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[15]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[16]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 52-447.
PubMed=9872672; DOI=10.1023/A:1009289625352;
O'Briant K.C., Ali S.Y., Weier H.-U.G., Bepler G.;
"An 84-kilobase physical map and repeat polymorphisms of the
gastrin/cholecystokinin brain receptor region at the junction of
chromosome segments 11p15.4 and 15.5.";
Chromosome Res. 6:415-418(1998).
[17]
NUCLEOTIDE SEQUENCE [MRNA] OF 244-333 (ISOFORMS 1/3), AND FUNCTION.
TISSUE=Fetal brain;
PubMed=8221657;
Sethi T., Herget T., Wu S.V., Walsh J.H., Rozengurt E.;
"CCKA and CCKB receptors are expressed in small cell lung cancer lines
and mediate Ca2+ mobilization and clonal growth.";
Cancer Res. 53:5208-5213(1993).
[18]
CHROMOSOMAL LOCATION.
PubMed=8222757;
Zimonjic D.B., Popescu N.C., Matsui T., Ito M., Chihara K.;
"Localization of the human cholecystokinin-B/gastrin receptor gene
(CCKBR) to chromosome 11p15.5-->p15.4 by fluorescence in situ
hybridization.";
Cytogenet. Cell Genet. 65:184-185(1994).
[19]
STRUCTURE BY NMR OF 352-379.
PubMed=11926817; DOI=10.1021/bi0160009;
Giragossian C., Mierke D.F.;
"Intermolecular interactions between cholecystokinin-8 and the third
extracellular loop of the cholecystokinin-2 receptor.";
Biochemistry 41:4560-4566(2002).
-!- FUNCTION: Receptor for gastrin and cholecystokinin. The CCK-B
receptors occur throughout the central nervous system where they
modulate anxiety, analgesia, arousal, and neuroleptic activity.
This receptor mediates its action by association with G proteins
that activate a phosphatidylinositol-calcium second messenger
system.
-!- FUNCTION: Isoform 2 is constitutively activated and may regulate
cancer cell proliferation via a gastrin-independent mechanism.
-!- INTERACTION:
P06307:CCK; NbExp=2; IntAct=EBI-1753137, EBI-6624436;
Q9P121:NTM; NbExp=3; IntAct=EBI-1753137, EBI-4315078;
Q06124:PTPN11; NbExp=5; IntAct=EBI-1753137, EBI-297779;
-!- SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=P32239-1; Sequence=Displayed;
Name=2; Synonyms=CCK-C, CCK-BRi4sv;
IsoId=P32239-2; Sequence=VSP_033445;
Name=3; Synonyms=DeltaCCK-B;
IsoId=P32239-3; Sequence=VSP_033444;
-!- TISSUE SPECIFICITY: Isoform 1 is expressed in brain, pancreas,
stomach, the colon cancer cell line LoVo and the T-lymphoblastoma
Jurkat, but not in heart, placenta, liver, lung, skeletal muscle,
kidney or the stomach cancer cell line AGS. Expressed at high
levels in the small cell lung cancer cell line NCI-H510, at lower
levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed
in GLC-19 cell line. Within the stomach, expressed at high levels
in the mucosa of the gastric fundus and at low levels in the
antrum and duodenum. Isoform 2 is present in pancreatic cancer
cells and colorectal cancer cells, but not in normal pancreas or
colonic mucosa. Isoform 3 is expressed in brain, pancreas,
stomach, the stomach cancer cell line AGS and the colon cancer
cell line LoVo. {ECO:0000269|PubMed:10913157,
ECO:0000269|PubMed:12429993, ECO:0000269|PubMed:7848914,
ECO:0000269|PubMed:7887934, ECO:0000269|PubMed:8185170,
ECO:0000269|PubMed:8349705}.
-!- SIMILARITY: Belongs to the G-protein coupled receptor 1 family.
{ECO:0000255|PROSITE-ProRule:PRU00521}.
-!- WEB RESOURCE: Name=Wikipedia; Note=Cholecystokinin receptor entry;
URL="https://en.wikipedia.org/wiki/Cholecystokinin_receptor";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; L04473; AAA35660.1; -; mRNA.
EMBL; L08112; AAA35657.1; -; mRNA.
EMBL; D13305; BAA02564.1; -; mRNA.
EMBL; L10822; AAC37528.1; -; Genomic_DNA.
EMBL; S70057; AAB30766.2; -; mRNA.
EMBL; D21219; BAA04759.2; -; Genomic_DNA.
EMBL; AF239668; AAF67174.1; -; mRNA.
EMBL; AY029770; AAK38351.1; -; mRNA.
EMBL; AF441129; AAN32829.1; -; mRNA.
EMBL; L07746; AAA91831.1; -; mRNA.
EMBL; AK292064; BAF84753.1; -; mRNA.
EMBL; AY322551; AAP84364.1; -; mRNA.
EMBL; BT006789; AAP35435.1; -; mRNA.
EMBL; BC000740; AAH00740.1; -; mRNA.
EMBL; AH006311; AAC27510.1; -; Genomic_DNA.
CCDS; CCDS7761.1; -. [P32239-1]
PIR; A47430; A47430.
PIR; I65231; I65231.
RefSeq; NP_001304958.1; NM_001318029.1.
RefSeq; NP_795344.1; NM_176875.3. [P32239-1]
RefSeq; XP_005253267.1; XM_005253210.1. [P32239-2]
RefSeq; XP_016874005.1; XM_017018516.1. [P32239-3]
UniGene; Hs.203; -.
PDB; 1L4T; NMR; -; A=352-379.
PDBsum; 1L4T; -.
ProteinModelPortal; P32239; -.
SMR; P32239; -.
BioGrid; 107329; 13.
DIP; DIP-229N; -.
IntAct; P32239; 11.
MINT; P32239; -.
STRING; 9606.ENSP00000335544; -.
BindingDB; P32239; -.
ChEMBL; CHEMBL298; -.
DrugBank; DB00183; Pentagastrin.
GuidetoPHARMACOLOGY; 77; -.
iPTMnet; P32239; -.
PhosphoSitePlus; P32239; -.
BioMuta; CCKBR; -.
DMDM; 417029; -.
PaxDb; P32239; -.
PeptideAtlas; P32239; -.
PRIDE; P32239; -.
ProteomicsDB; 54845; -.
ProteomicsDB; 54846; -. [P32239-2]
ProteomicsDB; 54847; -. [P32239-3]
DNASU; 887; -.
Ensembl; ENST00000334619; ENSP00000335544; ENSG00000110148. [P32239-1]
Ensembl; ENST00000525462; ENSP00000435534; ENSG00000110148. [P32239-2]
GeneID; 887; -.
KEGG; hsa:887; -.
UCSC; uc001mcp.4; human. [P32239-1]
CTD; 887; -.
DisGeNET; 887; -.
EuPathDB; HostDB:ENSG00000110148.9; -.
GeneCards; CCKBR; -.
HGNC; HGNC:1571; CCKBR.
MIM; 118445; gene.
neXtProt; NX_P32239; -.
OpenTargets; ENSG00000110148; -.
PharmGKB; PA26143; -.
eggNOG; KOG3656; Eukaryota.
eggNOG; ENOG410XRW9; LUCA.
GeneTree; ENSGT00920000148959; -.
HOVERGEN; HBG036927; -.
InParanoid; P32239; -.
KO; K04195; -.
OMA; WRAFDGP; -.
OrthoDB; EOG091G084J; -.
PhylomeDB; P32239; -.
TreeFam; TF315303; -.
Reactome; R-HSA-375276; Peptide ligand-binding receptors.
Reactome; R-HSA-416476; G alpha (q) signalling events.
Reactome; R-HSA-881907; Gastrin-CREB signalling pathway via PKC and MAPK.
SignaLink; P32239; -.
SIGNOR; P32239; -.
EvolutionaryTrace; P32239; -.
GeneWiki; Cholecystokinin_B_receptor; -.
GenomeRNAi; 887; -.
PRO; PR:P32239; -.
Proteomes; UP000005640; Chromosome 11.
Bgee; ENSG00000110148; -.
CleanEx; HS_CCKBR; -.
ExpressionAtlas; P32239; baseline and differential.
Genevisible; P32239; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0046935; F:1-phosphatidylinositol-3-kinase regulator activity; TAS:ProtInc.
GO; GO:0004951; F:cholecystokinin receptor activity; IDA:GO_Central.
GO; GO:0015054; F:gastrin receptor activity; IDA:UniProtKB.
GO; GO:0017046; F:peptide hormone binding; IPI:GO_Central.
GO; GO:0031741; F:type B gastrin/cholecystokinin receptor binding; IDA:NTNU_SB.
GO; GO:0008283; P:cell proliferation; TAS:ProtInc.
GO; GO:0007166; P:cell surface receptor signaling pathway; NAS:UniProtKB.
GO; GO:0038188; P:cholecystokinin signaling pathway; IDA:GO_Central.
GO; GO:0048565; P:digestive tract development; IEA:Ensembl.
GO; GO:0007186; P:G-protein coupled receptor signaling pathway; TAS:Reactome.
GO; GO:0001696; P:gastric acid secretion; IEA:Ensembl.
GO; GO:0048732; P:gland development; IEA:Ensembl.
GO; GO:0007200; P:phospholipase C-activating G-protein coupled receptor signaling pathway; IDA:GO_Central.
GO; GO:0008284; P:positive regulation of cell proliferation; IDA:UniProtKB.
GO; GO:0007204; P:positive regulation of cytosolic calcium ion concentration; IDA:UniProtKB.
InterPro; IPR009126; Cholcskin_rcpt.
InterPro; IPR000314; Gastrin_rcpt.
InterPro; IPR000276; GPCR_Rhodpsn.
InterPro; IPR017452; GPCR_Rhodpsn_7TM.
Pfam; PF00001; 7tm_1; 1.
PRINTS; PR01822; CCYSTOKININR.
PRINTS; PR00527; GASTRINR.
PRINTS; PR00237; GPCRRHODOPSN.
PROSITE; PS00237; G_PROTEIN_RECEP_F1_1; 1.
PROSITE; PS50262; G_PROTEIN_RECEP_F1_2; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cell membrane; Complete proteome;
Disulfide bond; G-protein coupled receptor; Glycoprotein; Lipoprotein;
Membrane; Palmitate; Polymorphism; Receptor; Reference proteome;
Transducer; Transmembrane; Transmembrane helix.
CHAIN 1 447 Gastrin/cholecystokinin type B receptor.
/FTId=PRO_0000069474.
TOPO_DOM 1 57 Extracellular. {ECO:0000255}.
TRANSMEM 58 79 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 80 87 Cytoplasmic. {ECO:0000255}.
TRANSMEM 88 109 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 110 131 Extracellular. {ECO:0000255}.
TRANSMEM 132 150 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 151 170 Cytoplasmic. {ECO:0000255}.
TRANSMEM 171 189 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 190 219 Extracellular. {ECO:0000255}.
TRANSMEM 220 242 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 243 333 Cytoplasmic. {ECO:0000255}.
TRANSMEM 334 355 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 356 373 Extracellular. {ECO:0000255}.
TRANSMEM 374 394 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 395 447 Cytoplasmic. {ECO:0000255}.
LIPID 408 408 S-palmitoyl cysteine. {ECO:0000250}.
CARBOHYD 7 7 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 30 30 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 36 36 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 127 205 {ECO:0000255|PROSITE-ProRule:PRU00521}.
VAR_SEQ 1 66 Missing (in isoform 3).
{ECO:0000303|PubMed:7887934}.
/FTId=VSP_033444.
VAR_SEQ 271 271 G -> GGAGPREQNLGEAELWRATGPAGVGGTEMKVRVRRK
LEMELSWERRSGGDWAGDWGDSPFSLTAHPLCSG (in
isoform 2). {ECO:0000303|PubMed:10913157,
ECO:0000303|PubMed:11495676,
ECO:0000303|PubMed:12429993}.
/FTId=VSP_033445.
VARIANT 37 37 L -> F (in dbSNP:rs1805000).
/FTId=VAR_014684.
VARIANT 77 77 V -> G (in dbSNP:rs35816985).
/FTId=VAR_049388.
VARIANT 125 125 V -> I (in dbSNP:rs1805002).
/FTId=VAR_014685.
VARIANT 215 215 R -> H (in dbSNP:rs1805004).
/FTId=VAR_014686.
VARIANT 319 319 R -> Q (in dbSNP:rs1805001).
/FTId=VAR_014687.
CONFLICT 64 64 I -> T (in Ref. 8; AAF67174).
{ECO:0000305}.
CONFLICT 93 93 L -> F (in Ref. 16; AAC27510).
{ECO:0000305}.
CONFLICT 96 96 L -> M (in Ref. 16; AAC27510).
{ECO:0000305}.
CONFLICT 116 116 L -> I (in Ref. 16; AAC27510).
{ECO:0000305}.
CONFLICT 171 171 A -> P (in Ref. 11; AAA91831).
{ECO:0000305}.
CONFLICT 227 227 F -> S (in Ref. 12; BAF84753).
{ECO:0000305}.
CONFLICT 249 249 L -> V (in Ref. 11; AAA91831).
{ECO:0000305}.
CONFLICT 288 288 E -> K (in Ref. 5; AAB30766).
{ECO:0000305}.
HELIX 353 358 {ECO:0000244|PDB:1L4T}.
HELIX 363 368 {ECO:0000244|PDB:1L4T}.
HELIX 372 378 {ECO:0000244|PDB:1L4T}.
SEQUENCE 447 AA; 48419 MW; BAEEFAD4C1F85915 CRC64;
MELLKLNRSV QGTGPGPGAS LCRPGAPLLN SSSVGNLSCE PPRIRGAGTR ELELAIRITL
YAVIFLMSVG GNMLIIVVLG LSRRLRTVTN AFLLSLAVSD LLLAVACMPF TLLPNLMGTF
IFGTVICKAV SYLMGVSVSV STLSLVAIAL ERYSAICRPL QARVWQTRSH AARVIVATWL
LSGLLMVPYP VYTVVQPVGP RVLQCVHRWP SARVRQTWSV LLLLLLFFIP GVVMAVAYGL
ISRELYLGLR FDGDSDSDSQ SRVRNQGGLP GAVHQNGRCR PETGAVGEDS DGCYVQLPRS
RPALELTALT APGPGSGSRP TQAKLLAKKR VVRMLLVIVV LFFLCWLPVY SANTWRAFDG
PGAHRALSGA PISFIHLLSY ASACVNPLVY CFMHRRFRQA CLETCARCCP RPPRARPRAL
PDEDPPTPSI ASLSRLSYTT ISTLGPG


Related products :

Catalog number Product name Quantity
E1051b ELISA Bos taurus,Bovine,CCK2-R,CCK-B receptor,CCKBR,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor 96T
E1051m ELISA kit CCK2-R,CCK-B receptor,Cckbr,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Mouse,Mus musculus 96T
U1051b CLIA Bos taurus,Bovine,CCK2-R,CCK-B receptor,CCKBR,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor 96T
U1051m CLIA CCK2-R,CCK-B receptor,Cckbr,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Mouse,Mus musculus 96T
E1051r ELISA kit CCK2-R,CCK-B receptor,Cckbr,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Rat,Rattus norvegicus 96T
E1051r ELISA CCK2-R,CCK-B receptor,Cckbr,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Rat,Rattus norvegicus 96T
U1051r CLIA CCK2-R,CCK-B receptor,Cckbr,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Rat,Rattus norvegicus 96T
E1051b ELISA kit Bos taurus,Bovine,CCK2-R,CCK-B receptor,CCKBR,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor 96T
E1051m ELISA CCK2-R,CCK-B receptor,Cckbr,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Mouse,Mus musculus 96T
E1051Rb ELISA CCK2-R,CCK-B receptor,CCKBR,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Oryctolagus cuniculus,Rabbit 96T
E1051Rb ELISA kit CCK2-R,CCK-B receptor,CCKBR,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Oryctolagus cuniculus,Rabbit 96T
U1051Rb CLIA CCK2-R,CCK-B receptor,CCKBR,CCK-BR,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Oryctolagus cuniculus,Rabbit 96T
E1051h ELISA kit CCK2-R,CCK-B receptor,CCKBR,CCK-BR,CCKRB,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Homo sapiens,Human 96T
E1051h ELISA CCK2-R,CCK-B receptor,CCKBR,CCK-BR,CCKRB,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Homo sapiens,Human 96T
U1051h CLIA CCK2-R,CCK-B receptor,CCKBR,CCK-BR,CCKRB,Cholecystokinin-2 receptor,Gastrin_cholecystokinin type B receptor,Homo sapiens,Human 96T
EIAAB06107 CCK1-R,CCK-A receptor,CCKAR,CCK-AR,CCKRA,Cholecystokinin receptor type A,Cholecystokinin-1 receptor,Homo sapiens,Human
EIAAB06103 CCK1-R,CCK-A receptor,CCKAR,CCK-AR,Cholecystokinin receptor type A,Cholecystokinin-1 receptor,Oryctolagus cuniculus,Rabbit
EIAAB06105 CCK1-R,CCK-A receptor,Cckar,CCK-AR,Cholecystokinin receptor type A,Cholecystokinin-1 receptor,Mouse,Mus musculus
EIAAB06104 CCK1-R,CCK-A receptor,Cckar,CCK-AR,Cholecystokinin receptor type A,Cholecystokinin-1 receptor,Rat,Rattus norvegicus
U1051c CLIA Canis familiaris,Canis lupus familiaris,CCK2-R,CCK-B receptor,CCKBR,CCK-BR,Cholecystokinin-2 receptor,Dog,Gastrin_cholecystokinin type B receptor 96T
E1051c ELISA Canis familiaris,Canis lupus familiaris,CCK2-R,CCK-B receptor,CCKBR,CCK-BR,Cholecystokinin-2 receptor,Dog,Gastrin_cholecystokinin type B receptor 96T
E1051c ELISA kit Canis familiaris,Canis lupus familiaris,CCK2-R,CCK-B receptor,CCKBR,CCK-BR,Cholecystokinin-2 receptor,Dog,Gastrin_cholecystokinin type B receptor 96T
18-461-10740 Cholecystokinin type A receptor - CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R Polyclonal 0.05 ml
18-461-10739 Cholecystokinin type A receptor - CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R Polyclonal 0.05 ml
AE1129AG.1 Cholecystokinin Receptor (CCK-R) antigen: human Cholecystokinin-Receptor Type A (aa 180-195) 100


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur