Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

General transcription factor II-I repeat domain-containing protein 1 (GTF2I repeat domain-containing protein 1) (Binding factor for early enhancer)

 GT2D1_MOUSE             Reviewed;        1104 AA.
Q9JI57; Q547E0; Q80WJ8; Q80WJ9; Q80WK0; Q80WK1; Q8R4X5; Q8R4X6;
Q8R4X7; Q8R4X8; Q8VHD5; Q8VI58; Q9EQE7; Q9ESZ6; Q9ESZ7;
27-MAY-2002, integrated into UniProtKB/Swiss-Prot.
27-MAY-2002, sequence version 2.
28-MAR-2018, entry version 138.
RecName: Full=General transcription factor II-I repeat domain-containing protein 1;
Short=GTF2I repeat domain-containing protein 1;
AltName: Full=Binding factor for early enhancer;
Name=Gtf2ird1; Synonyms=Ben;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
STRAIN=Swiss Webster / NIH;
PubMed=10861001; DOI=10.1073/pnas.97.13.7342;
Bayarsaihan D., Ruddle F.H.;
"Isolation and characterization of BEN, a member of the TFII-I family
of DNA-binding proteins containing distinct helix-loop-helix
domains.";
Proc. Natl. Acad. Sci. U.S.A. 97:7342-7347(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
STRAIN=C57BL/6J;
PubMed=11352562; DOI=10.1006/geno.2001.6507;
Durkin M.E., Keck-Waggoner C.L., Popescu N.C., Thorgeirsson S.S.;
"Integration of a c-myc transgene results in disruption of the mouse
Gtf2ird1 gene, the homologue of the human GTF2IRD1 gene hemizygously
deleted in Williams-Beuren syndrome.";
Genomics 73:20-27(2001).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
STRAIN=129/SvJ;
PubMed=11827466; DOI=10.1006/geno.2001.6674;
Bayarsaihan D., Dunai J., Greally J.M., Kawasaki K., Sumiyama K.,
Enkhmandakh B., Shimizu N., Ruddle F.H.;
"Genomic organization of the genes Gtf2ird1, Gtf2i, and Ncf1 at the
mouse chromosome 5 region syntenic to the human chromosome 7q11.23
Williams syndrome critical region.";
Genomics 79:137-143(2002).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND
10), AND SUBCELLULAR LOCATION.
STRAIN=BALB/cJ, and C57BL/6 X DBA/2; TISSUE=Skeletal muscle;
PubMed=12780350; DOI=10.1042/BJ20030189;
Tay E.S.E., Guven K.L., Subramaniam N., Polly P., Issa L.L.,
Gunning P.W., Hardeman E.C.;
"Regulation of alternative splicing of Gtf2ird1 and its impact on slow
muscle promoter activity.";
Biochem. J. 374:359-367(2003).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3).
STRAIN=129/Sv;
Green E.D.;
Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases.
[6]
FUNCTION.
PubMed=11438732; DOI=10.1073/pnas.141222298;
Tussie-Luna M.I., Bayarsaihan D., Ruddle F.H., Roy A.L.;
"Repression of TFII-I-dependent transcription by nuclear exclusion.";
Proc. Natl. Acad. Sci. U.S.A. 98:7789-7794(2001).
-!- FUNCTION: May be a transcription regulator involved in cell-cycle
progression and skeletal muscle differentiation. May repress GTF2I
transcriptional functions, by preventing its nuclear residency, or
by inhibiting its transcriptional activation. May contribute to
slow-twitch fiber type specificity during myogenesis and in
regenerating muscles. Binds troponin I slow-muscle fiber enhancer
(USE B1). Binds specifically and with high affinity to the EFG
sequences derived from the early enhancer of HOXC8.
{ECO:0000269|PubMed:11438732}.
-!- SUBUNIT: Interacts with the retinoblastoma protein (RB1) via its
C-terminus. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-
ProRule:PRU00484, ECO:0000269|PubMed:12780350}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=10;
Name=2; Synonyms=Beta, 3b7;
IsoId=Q9JI57-1; Sequence=Displayed;
Name=1; Synonyms=Alpha, 3a7;
IsoId=Q9JI57-2; Sequence=VSP_003876;
Name=3; Synonyms=Gamma, 1a1;
IsoId=Q9JI57-3; Sequence=VSP_003874, VSP_003875, VSP_003876;
Name=4; Synonyms=1b1;
IsoId=Q9JI57-4; Sequence=VSP_003874, VSP_003875;
Name=5; Synonyms=3b5;
IsoId=Q9JI57-5; Sequence=VSP_003874;
Name=6; Synonyms=3b3;
IsoId=Q9JI57-6; Sequence=VSP_021376, VSP_003874;
Name=7; Synonyms=3a3;
IsoId=Q9JI57-7; Sequence=VSP_021376, VSP_003874, VSP_003876;
Name=8; Synonyms=1b4;
IsoId=Q9JI57-8; Sequence=VSP_003875;
Name=9; Synonyms=2a5;
IsoId=Q9JI57-9; Sequence=VSP_021377, VSP_003876;
Name=10; Synonyms=1a4;
IsoId=Q9JI57-10; Sequence=VSP_003875, VSP_003876;
-!- TISSUE SPECIFICITY: Widely expressed.
-!- DEVELOPMENTAL STAGE: Expressed in somites, neural tube and brain
at E8-8.5. Expression remains constant from E9.5-E12.5 with
highest expression levels in the limb buds, branchial arches,
crainofacial area, brain and spinal cord.
-!- SIMILARITY: Belongs to the TFII-I family. {ECO:0000255|PROSITE-
ProRule:PRU00484}.
-!- SEQUENCE CAUTION:
Sequence=AAF78367.1; Type=Frameshift; Positions=217, 243; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF260133; AAF78367.1; ALT_FRAME; mRNA.
EMBL; AF257475; AAG44655.1; -; mRNA.
EMBL; AY030287; AAK49782.1; -; mRNA.
EMBL; AY030288; AAK49783.1; -; mRNA.
EMBL; AY030289; AAK49784.1; -; mRNA.
EMBL; AF247161; AAL68980.1; -; mRNA.
EMBL; AF343348; AAM02920.1; -; mRNA.
EMBL; AF343349; AAM02921.1; -; mRNA.
EMBL; AF343350; AAM02922.1; -; mRNA.
EMBL; AF343351; AAM02923.1; -; mRNA.
EMBL; AF497637; AAP30728.1; -; mRNA.
EMBL; AF497638; AAP30729.1; -; mRNA.
EMBL; AF497639; AAP30730.1; -; mRNA.
EMBL; AF497640; AAP30731.1; -; mRNA.
EMBL; AF497641; AAP30732.1; -; mRNA.
EMBL; AF497642; AAP30733.1; -; mRNA.
EMBL; AF289666; AAF99337.1; -; Genomic_DNA.
EMBL; AF289667; AAF99339.1; -; Genomic_DNA.
CCDS; CCDS39302.1; -. [Q9JI57-7]
CCDS; CCDS39303.1; -. [Q9JI57-9]
CCDS; CCDS39305.1; -. [Q9JI57-2]
CCDS; CCDS39306.1; -. [Q9JI57-5]
CCDS; CCDS39307.1; -. [Q9JI57-1]
CCDS; CCDS51657.1; -. [Q9JI57-8]
CCDS; CCDS80420.1; -. [Q9JI57-10]
CCDS; CCDS84967.1; -. [Q9JI57-6]
RefSeq; NP_001074931.1; NM_001081462.2. [Q9JI57-1]
RefSeq; NP_001074932.1; NM_001081463.2. [Q9JI57-5]
RefSeq; NP_001074935.1; NM_001081466.2. [Q9JI57-7]
RefSeq; NP_001074936.1; NM_001081467.2. [Q9JI57-8]
RefSeq; NP_001074938.1; NM_001081469.2. [Q9JI57-10]
RefSeq; NP_001074939.1; NM_001081470.2. [Q9JI57-3]
RefSeq; NP_001231865.1; NM_001244936.1. [Q9JI57-4]
RefSeq; NP_001334417.1; NM_001347488.1. [Q9JI57-6]
RefSeq; NP_065064.2; NM_020331.3. [Q9JI57-2]
RefSeq; XP_017176527.1; XM_017321038.1. [Q9JI57-1]
RefSeq; XP_017176528.1; XM_017321039.1. [Q9JI57-5]
UniGene; Mm.332735; -.
ProteinModelPortal; Q9JI57; -.
SMR; Q9JI57; -.
IntAct; Q9JI57; 1.
STRING; 10090.ENSMUSP00000098217; -.
iPTMnet; Q9JI57; -.
PhosphoSitePlus; Q9JI57; -.
PaxDb; Q9JI57; -.
PRIDE; Q9JI57; -.
Ensembl; ENSMUST00000073161; ENSMUSP00000072904; ENSMUSG00000023079. [Q9JI57-2]
Ensembl; ENSMUST00000074114; ENSMUSP00000073752; ENSMUSG00000023079. [Q9JI57-8]
Ensembl; ENSMUST00000100650; ENSMUSP00000098215; ENSMUSG00000023079. [Q9JI57-5]
Ensembl; ENSMUST00000100652; ENSMUSP00000098217; ENSMUSG00000023079. [Q9JI57-1]
Ensembl; ENSMUST00000100654; ENSMUSP00000098219; ENSMUSG00000023079. [Q9JI57-9]
Ensembl; ENSMUST00000111245; ENSMUSP00000106876; ENSMUSG00000023079. [Q9JI57-7]
Ensembl; ENSMUST00000167084; ENSMUSP00000132882; ENSMUSG00000023079. [Q9JI57-10]
Ensembl; ENSMUST00000200944; ENSMUSP00000143848; ENSMUSG00000023079. [Q9JI57-10]
Ensembl; ENSMUST00000202554; ENSMUSP00000143809; ENSMUSG00000023079. [Q9JI57-6]
GeneID; 57080; -.
KEGG; mmu:57080; -.
UCSC; uc008zvv.2; mouse. [Q9JI57-2]
UCSC; uc008zvw.2; mouse. [Q9JI57-7]
UCSC; uc008zvx.2; mouse. [Q9JI57-3]
UCSC; uc008zvy.2; mouse. [Q9JI57-10]
UCSC; uc008zvz.2; mouse. [Q9JI57-9]
UCSC; uc008zwa.2; mouse. [Q9JI57-8]
UCSC; uc008zwb.2; mouse. [Q9JI57-6]
UCSC; uc008zwc.2; mouse. [Q9JI57-4]
UCSC; uc008zwd.2; mouse. [Q9JI57-5]
UCSC; uc008zwe.2; mouse. [Q9JI57-1]
CTD; 9569; -.
MGI; MGI:1861942; Gtf2ird1.
eggNOG; ENOG410IEPZ; Eukaryota.
eggNOG; ENOG41100H8; LUCA.
GeneTree; ENSGT00530000063863; -.
HOVERGEN; HBG051855; -.
InParanoid; Q9JI57; -.
KO; K03121; -.
OMA; MYMVDYA; -.
OrthoDB; EOG091G019P; -.
PhylomeDB; Q9JI57; -.
TreeFam; TF352524; -.
ChiTaRS; Alcam; mouse.
PRO; PR:Q9JI57; -.
Proteomes; UP000000589; Chromosome 5.
Bgee; ENSMUSG00000023079; -.
ExpressionAtlas; Q9JI57; baseline and differential.
Genevisible; Q9JI57; MM.
GO; GO:0005737; C:cytoplasm; IBA:GO_Central.
GO; GO:0005829; C:cytosol; ISO:MGI.
GO; GO:0005654; C:nucleoplasm; ISO:MGI.
GO; GO:0005634; C:nucleus; IDA:MGI.
GO; GO:0003677; F:DNA binding; IBA:GO_Central.
GO; GO:0003700; F:DNA binding transcription factor activity; IDA:MGI.
GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; IBA:GO_Central.
GO; GO:0007275; P:multicellular organism development; IEA:UniProtKB-KW.
GO; GO:0006366; P:transcription by RNA polymerase II; IEA:InterPro.
GO; GO:0014886; P:transition between slow and fast fiber; IDA:MGI.
Gene3D; 3.90.1460.10; -; 6.
InterPro; IPR004212; GTF2I.
InterPro; IPR036647; GTF2I-like_rpt_sf.
InterPro; IPR016659; TF_II-I.
Pfam; PF02946; GTF2I; 6.
PIRSF; PIRSF016441; TF_II-I; 1.
SUPFAM; SSF117773; SSF117773; 6.
PROSITE; PS51139; GTF2I; 6.
2: Evidence at transcript level;
Alternative splicing; Complete proteome; Developmental protein;
DNA-binding; Isopeptide bond; Nucleus; Phosphoprotein;
Reference proteome; Repeat; Transcription; Transcription regulation;
Ubl conjugation.
CHAIN 1 1104 General transcription factor II-I repeat
domain-containing protein 1.
/FTId=PRO_0000083871.
REPEAT 119 213 GTF2I-like 1.
REPEAT 342 436 GTF2I-like 2.
REPEAT 556 650 GTF2I-like 3.
REPEAT 681 775 GTF2I-like 4.
REPEAT 805 899 GTF2I-like 5.
REPEAT 908 1002 GTF2I-like 6.
MOTIF 1012 1019 Nuclear localization signal.
{ECO:0000250}.
COMPBIAS 1020 1043 Ser-rich.
MOD_RES 448 448 Phosphoserine.
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 27 27 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 184 184 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 212 212 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 225 225 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 238 238 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 271 271 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 337 337 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 436 436 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 439 439 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 443 443 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 567 567 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 579 579 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 588 588 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 622 622 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 638 638 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 669 669 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 709 709 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 717 717 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 757 757 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 759 759 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 772 772 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 841 841 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
CROSSLNK 901 901 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q9UHL9}.
VAR_SEQ 657 675 Missing (in isoform 6 and isoform 7).
{ECO:0000303|PubMed:12780350}.
/FTId=VSP_021376.
VAR_SEQ 703 800 Missing (in isoform 9).
{ECO:0000303|PubMed:12780350}.
/FTId=VSP_021377.
VAR_SEQ 774 800 Missing (in isoform 3, isoform 4, isoform
5, isoform 6 and isoform 7).
{ECO:0000303|PubMed:11827466,
ECO:0000303|PubMed:12780350}.
/FTId=VSP_003874.
VAR_SEQ 864 966 Missing (in isoform 3, isoform 4, isoform
8 and isoform 10).
{ECO:0000303|PubMed:11827466,
ECO:0000303|PubMed:12780350}.
/FTId=VSP_003875.
VAR_SEQ 1051 1104 VKSRGSELHPNSVWPLPLPRAGPSTAPGTGRHWALRGTQPT
TEGQAHPLVLPTR -> QWPVYMVDYSGLNVQLPGPLDY
(in isoform 1, isoform 3, isoform 7,
isoform 9 and isoform 10).
{ECO:0000303|PubMed:10861001,
ECO:0000303|PubMed:11827466,
ECO:0000303|PubMed:12780350}.
/FTId=VSP_003876.
CONFLICT 79 79 E -> V (in Ref. 4; AAM02923).
{ECO:0000305}.
CONFLICT 94 94 N -> D (in Ref. 1; AAF78367).
{ECO:0000305}.
CONFLICT 134 134 E -> K (in Ref. 4; AAM02920).
{ECO:0000305}.
CONFLICT 252 252 S -> F (in Ref. 1; AAF78367).
{ECO:0000305}.
CONFLICT 258 258 Y -> H (in Ref. 1; AAF78367).
{ECO:0000305}.
CONFLICT 261 261 S -> L (in Ref. 1; AAF78367).
{ECO:0000305}.
CONFLICT 283 283 D -> G (in Ref. 1; AAF78367).
{ECO:0000305}.
CONFLICT 399 399 K -> R (in Ref. 4; AAL68980).
{ECO:0000305}.
CONFLICT 821 821 L -> F (in Ref. 4; AAM02920/AAP30731).
{ECO:0000305}.
CONFLICT 881 881 H -> Y (in Ref. 4; AAM02923).
{ECO:0000305}.
CONFLICT 1058 1058 L -> P (in Ref. 4; AAP30733/AAM02922).
{ECO:0000305}.
SEQUENCE 1104 AA; 123483 MW; C76B2AF3CD1BCD73 CRC64;
MALLGKHCDI PTNGCGSERW NSTFARKDEL INSLVSALDS MCSALSKLNT EVACVAVHNE
SVFVMGTEKG RVFLNTRKEL QSDFLRFCRG PLWNDPEAGH PKKVQRCEGG GRSLPRSSLE
QCSDVYLLQK MVEEVFDVLY SEAMGRATVV PLPYERLLRE PGLLAVQGLP EGLAFRRPAE
YDPKALMAIL EHSHRIRFKL RRPPDDGGQD TKALVEMNGI SLLPKGSRDC GLHGQASKVA
PQDLTPTATP SSMANFLYST SMPNHTIREL KQEVPTCPLT PSDLGMGWPV PEPHVPSTQD
FSDCCGQTPA GPAGPLIQNV HASKRILFSI VHDKSEKWDP FIKEMEDINT LRECVQILFN
SRYAEALGLD HMVPVPYRKI ACDPEAVEIV GIPDKIPFKR PCTYGVPKLK RILEERHSIH
FIIKRMFDER IFTGNKFTKD PMKLEPASPP EDTSTEVCRD SMLDLAGTAW SDMSSVSEDC
GPGTSGEIAM LRPIKIEPEE LDIIQVTVSD PSPTSEEMTD SLPGHLPSED SGYGMEMPAD
KGPSEEPWSE ERPAEESPGD VIRPLRKQVE MLFNTKYAKA IGTSEPVKVP YSKFLMHPEE
LFVLGLPEGI SLRRPNCFGI AKLRKILEAS NSIQFVIKRP ELLTDGVKEP VLDTQERDSW
DRLVDETPKR QGLQENYNTR LSRIDIANTL REQVQDLFNK KYGEALGIKY PVQVPYKRIK
SNPGSVIIEG LPPGIPFRKP CTFGSQNLER ILSVADKIKF TVTRPFQGLI PKPETKILTT
GHEAGKTTRP RRLQQDTWQP DEDDANRLGE KVILREQVKE LFNEKYGEAL GLNRPVLVPY
KLIRDSPDAV EVKGLPDDIP FRNPNTYDIH RLEKILKARE HVRMVIINQL QPFAEVCNDP
KVPEEDDSNK LGKKVILREQ VKELFNEKYG EALGLNRPVL VPYKLIRDSP DAVEVKGLPD
DIPFRNPNTY DIHRLEKILK AREHVRMVII NQLQPFGDVC NNAKVPAKDN IPKRKRKRVS
EGNSVSSSSS SSSSSSNPES VASTNQISLV VKSRGSELHP NSVWPLPLPR AGPSTAPGTG
RHWALRGTQP TTEGQAHPLV LPTR


Related products :

Catalog number Product name Quantity
GT2D1_HUMAN Human ELISA Kit FOR General transcription factor II-I repeat domain-containing protein 1 96T
CSB-EL010019MO Mouse General transcription factor II-I repeat domain-containing protein 2A(GTF2IRD2) ELISA kit 96T
CSB-EL010020HU Human General transcription factor II-I repeat domain-containing protein 2B(GTF2IRD2B) ELISA kit 96T
CSB-EL010018HU Human General transcription factor II-I repeat domain-containing protein 1(GTF2IRD1) ELISA kit 96T
CSB-EL010018MO Mouse General transcription factor II-I repeat domain-containing protein 1(GTF2IRD1) ELISA kit 96T
CSB-EL010019HU Human General transcription factor II-I repeat domain-containing protein 2A(GTF2IRD2) ELISA kit 96T
CSB-EL010019BO Bovine General transcription factor II-I repeat domain-containing protein 2A(GTF2IRD2) ELISA kit 96T
CSB-EL010019BO Bovine General transcription factor II-I repeat domain-containing protein 2A(GTF2IRD2) ELISA kit SpeciesBovine 96T
CSB-EL010020HU Human General transcription factor II-I repeat domain-containing protein 2B(GTF2IRD2B) ELISA kit SpeciesHuman 96T
CSB-EL010019HU Human General transcription factor II-I repeat domain-containing protein 2A(GTF2IRD2) ELISA kit SpeciesHuman 96T
CSB-EL010018HU Human General transcription factor II-I repeat domain-containing protein 1(GTF2IRD1) ELISA kit SpeciesHuman 96T
CSB-EL010019MO Mouse General transcription factor II-I repeat domain-containing protein 2A(GTF2IRD2) ELISA kit SpeciesMouse 96T
CSB-EL010018MO Mouse General transcription factor II-I repeat domain-containing protein 1(GTF2IRD1) ELISA kit SpeciesMouse 96T
GT2D1_MOUSE ELISA Kit FOR General transcription factor II-I repeat domain-containing protein 1; organism: Mouse; gene name: Gtf2ird1 96T
GT2D2_MOUSE ELISA Kit FOR General transcription factor II-I repeat domain-containing protein 2; organism: Mouse; gene name: Gtf2ird2 96T
EIAAB06739 BRUNOL1,Bruno-like protein 1,CAG repeat protein 4,CAGH4,CELF3,CELF-3,CUG-BP- and ETR-3-like factor 3,CUGBP Elav-like family member 3,ELAV-type RNA-binding protein 1,ERDA4,ETR-1,Expanded repeat domain
U1602h CLIA Homo sapiens,Human,OCT6,Oct-6,Octamer-binding protein 6,Octamer-binding transcription factor 6,OTF6,OTF-6,POU domain transcription factor SCIP,POU domain, class 3, transcription factor 1,POU3F1 96T
E1602h ELISA Homo sapiens,Human,OCT6,Oct-6,Octamer-binding protein 6,Octamer-binding transcription factor 6,OTF6,OTF-6,POU domain transcription factor SCIP,POU domain, class 3, transcription factor 1,POU3F1 96T
E1602h ELISA kit Homo sapiens,Human,OCT6,Oct-6,Octamer-binding protein 6,Octamer-binding transcription factor 6,OTF6,OTF-6,POU domain transcription factor SCIP,POU domain, class 3, transcription factor 1,PO 96T
E1602m ELISA Mouse,Mus musculus,Oct6,Oct-6,Octamer-binding protein 6,Octamer-binding transcription factor 6,Otf6,OTF-6,Otf-6,POU domain transcription factor SCIP,POU domain, class 3, transcription factor 1,P 96T
U1602m CLIA Mouse,Mus musculus,Oct6,Oct-6,Octamer-binding protein 6,Octamer-binding transcription factor 6,Otf6,OTF-6,Otf-6,POU domain transcription factor SCIP,POU domain, class 3, transcription factor 1,Po 96T
EIAAB46368 DXImx38e,Mouse,Mus musculus,WD repeat domain phosphoinositide-interacting protein 4,WD repeat domain X-linked 1,WD repeat-containing protein 45,Wdr45,Wdrx1,Wipi4,WIPI-4
E1602r ELISA Oct-6,Oct-6,Octamer-binding protein 6,Octamer-binding transcription factor 6,Otf6,OTF-6,Otf-6,POU domain transcription factor SCIP,POU domain, class 3, transcription factor 1,Pou3f1,Rat,Rattus n 96T
U1602r CLIA Oct-6,Oct-6,Octamer-binding protein 6,Octamer-binding transcription factor 6,Otf6,OTF-6,Otf-6,POU domain transcription factor SCIP,POU domain, class 3, transcription factor 1,Pou3f1,Rat,Rattus no 96T
E1602r ELISA kit Oct-6,Oct-6,Octamer-binding protein 6,Octamer-binding transcription factor 6,Otf6,OTF-6,Otf-6,POU domain transcription factor SCIP,POU domain, class 3, transcription factor 1,Pou3f1,Rat,Rat 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur