Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Glucagon family neuropeptides [Cleaved into: Growth hormone-releasing factor 1-46 (GRF) (Growth hormone-releasing hormone) (GHRH); Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27) (PACAP27); Pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) (PACAP38)]

 PACA_CHICK              Reviewed;         175 AA.
P41534; Q53WW0;
01-NOV-1995, integrated into UniProtKB/Swiss-Prot.
15-JUL-1998, sequence version 2.
05-DEC-2018, entry version 99.
RecName: Full=Glucagon family neuropeptides;
Contains:
RecName: Full=Growth hormone-releasing factor 1-46;
Short=GRF;
AltName: Full=Growth hormone-releasing hormone;
Short=GHRH;
Contains:
RecName: Full=Pituitary adenylate cyclase-activating polypeptide 27;
Short=PACAP-27;
Short=PACAP27;
Contains:
RecName: Full=Pituitary adenylate cyclase-activating polypeptide 38;
Short=PACAP-38;
Short=PACAP38;
Flags: Precursor;
Name=ADCYAP1;
Gallus gallus (Chicken).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
Phasianidae; Phasianinae; Gallus.
NCBI_TaxID=9031;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA].
PubMed=9022048; DOI=10.1089/dna.1997.16.95;
McRory J.E., Parker R.L., Sherwood N.M.;
"Expression and alternative processing of a chicken gene encoding both
growth hormone-releasing hormone and pituitary adenylate cyclase-
activating polypeptide.";
DNA Cell Biol. 16:95-102(1997).
[2]
PROTEIN SEQUENCE OF 131-168, AND AMIDATION AT LEU-157 AND LYS-168.
Yasuhara T., Mizuno K., Somogyvari-Vigh A., Komaki G., Arimura A.;
"Isolation and primary structure of chicken PACAP.";
Regul. Pept. 37:326-326(1992).
-!- FUNCTION: Primary role of GRF is to release GH from the pituitary.
-!- FUNCTION: PACAP plays pivotal roles as a neurotransmitter and/or a
neuromodulator.
-!- SUBCELLULAR LOCATION: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=GRF 1-46;
IsoId=P41534-1; Sequence=Displayed;
Name=GRF 1-43;
IsoId=P41534-2; Sequence=VSP_001760;
Name=GRF 33-46;
IsoId=P41534-3; Sequence=VSP_001759;
-!- SIMILARITY: Belongs to the glucagon family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; U71183; AAB51200.1; -; mRNA.
EMBL; U71184; AAB51201.1; -; mRNA.
EMBL; U71185; AAB51202.1; -; mRNA.
EMBL; U67275; AAC64494.1; -; Genomic_DNA.
PIR; A61070; A61070.
UniGene; Gga.51518; -.
UniGene; Gga.52384; -.
UniGene; Gga.616; -.
ProteinModelPortal; P41534; -.
SMR; P41534; -.
HOVERGEN; HBG018069; -.
InParanoid; P41534; -.
PhylomeDB; P41534; -.
Proteomes; UP000000539; Unplaced.
GO; GO:0005623; C:cell; IDA:AgBase.
GO; GO:0044297; C:cell body; IDA:AgBase.
GO; GO:0070852; C:cell body fiber; IDA:AgBase.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0043005; C:neuron projection; IDA:AgBase.
GO; GO:0043204; C:perikaryon; IDA:AgBase.
GO; GO:0043195; C:terminal bouton; IBA:GO_Central.
GO; GO:0005184; F:neuropeptide hormone activity; IBA:GO_Central.
GO; GO:0051428; F:peptide hormone receptor binding; IBA:GO_Central.
GO; GO:0016521; F:pituitary adenylate cyclase activating polypeptide activity; IBA:GO_Central.
GO; GO:0031858; F:pituitary adenylate cyclase-activating polypeptide receptor binding; IBA:GO_Central.
GO; GO:0007189; P:adenylate cyclase-activating G protein-coupled receptor signaling pathway; IBA:GO_Central.
GO; GO:0002118; P:aggressive behavior; IMP:AgBase.
GO; GO:0046034; P:ATP metabolic process; IBA:GO_Central.
GO; GO:0001662; P:behavioral fear response; IBA:GO_Central.
GO; GO:0071385; P:cellular response to glucocorticoid stimulus; IBA:GO_Central.
GO; GO:0042756; P:drinking behavior; IMP:AgBase.
GO; GO:0001821; P:histamine secretion; IBA:GO_Central.
GO; GO:0030073; P:insulin secretion; ISS:UniProtKB.
GO; GO:0040011; P:locomotion; IMP:AgBase.
GO; GO:0002865; P:negative regulation of acute inflammatory response to antigenic stimulus; IBA:GO_Central.
GO; GO:0002878; P:negative regulation of acute inflammatory response to non-antigenic stimulus; IBA:GO_Central.
GO; GO:0045786; P:negative regulation of cell cycle; IBA:GO_Central.
GO; GO:0060253; P:negative regulation of glial cell proliferation; IBA:GO_Central.
GO; GO:0034260; P:negative regulation of GTPase activity; IBA:GO_Central.
GO; GO:0010656; P:negative regulation of muscle cell apoptotic process; IBA:GO_Central.
GO; GO:0043267; P:negative regulation of potassium ion transport; IBA:GO_Central.
GO; GO:0031175; P:neuron projection development; IBA:GO_Central.
GO; GO:0007218; P:neuropeptide signaling pathway; IBA:GO_Central.
GO; GO:0001541; P:ovarian follicle development; IBA:GO_Central.
GO; GO:0021983; P:pituitary gland development; IBA:GO_Central.
GO; GO:0097755; P:positive regulation of blood vessel diameter; IBA:GO_Central.
GO; GO:0043950; P:positive regulation of cAMP-mediated signaling; IBA:GO_Central.
GO; GO:0008284; P:positive regulation of cell proliferation; IBA:GO_Central.
GO; GO:0071651; P:positive regulation of chemokine (C-C motif) ligand 5 production; IBA:GO_Central.
GO; GO:0007204; P:positive regulation of cytosolic calcium ion concentration; ISS:UniProtKB.
GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; IBA:GO_Central.
GO; GO:0010628; P:positive regulation of gene expression; ISS:UniProtKB.
GO; GO:0060124; P:positive regulation of growth hormone secretion; ISS:UniProtKB.
GO; GO:0043547; P:positive regulation of GTPase activity; IBA:GO_Central.
GO; GO:0046887; P:positive regulation of hormone secretion; IDA:AgBase.
GO; GO:0032755; P:positive regulation of interleukin-6 production; IBA:GO_Central.
GO; GO:0010976; P:positive regulation of neuron projection development; IBA:GO_Central.
GO; GO:0045860; P:positive regulation of protein kinase activity; IBA:GO_Central.
GO; GO:0090274; P:positive regulation of somatostatin secretion; IBA:GO_Central.
GO; GO:0051968; P:positive regulation of synaptic transmission, glutamatergic; IBA:GO_Central.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IBA:GO_Central.
GO; GO:0008277; P:regulation of G protein-coupled receptor signaling pathway; IBA:GO_Central.
GO; GO:0070445; P:regulation of oligodendrocyte progenitor proliferation; IBA:GO_Central.
GO; GO:0060078; P:regulation of postsynaptic membrane potential; IBA:GO_Central.
GO; GO:0032880; P:regulation of protein localization; IBA:GO_Central.
GO; GO:0045471; P:response to ethanol; IBA:GO_Central.
GO; GO:0042594; P:response to starvation; IBA:GO_Central.
GO; GO:0019233; P:sensory perception of pain; IBA:GO_Central.
GO; GO:0035176; P:social behavior; IMP:AgBase.
InterPro; IPR000532; Glucagon_GIP_secretin_VIP.
InterPro; IPR039080; PACAP.
PANTHER; PTHR11213:SF1; PTHR11213:SF1; 1.
Pfam; PF00123; Hormone_2; 2.
SMART; SM00070; GLUCA; 2.
PROSITE; PS00260; GLUCAGON; 2.
1: Evidence at protein level;
Alternative splicing; Amidation; Cleavage on pair of basic residues;
Complete proteome; Direct protein sequencing; Hormone;
Reference proteome; Secreted; Signal.
SIGNAL 1 23 {ECO:0000255}.
PROPEP 24 80
/FTId=PRO_0000011511.
PEPTIDE 83 128 Growth hormone-releasing factor 1-46.
/FTId=PRO_0000011512.
PEPTIDE 131 168 Pituitary adenylate cyclase-activating
polypeptide 38.
/FTId=PRO_0000011513.
PEPTIDE 131 157 Pituitary adenylate cyclase-activating
polypeptide 27.
/FTId=PRO_0000011514.
PROPEP 172 175
/FTId=PRO_0000011515.
MOD_RES 157 157 Leucine amide. {ECO:0000269|Ref.2}.
MOD_RES 168 168 Lysine amide. {ECO:0000269|Ref.2}.
VAR_SEQ 82 114 RHADGIFSKAYRKLLGQLSARNYLHSLMAKRVG -> S
(in isoform GRF 33-46). {ECO:0000305}.
/FTId=VSP_001759.
VAR_SEQ 115 117 Missing (in isoform GRF 1-43).
{ECO:0000305}.
/FTId=VSP_001760.
SEQUENCE 175 AA; 19561 MW; 0DB54995F0AA9DFB CRC64;
MSGNVYKTLL TLLVYGLIMH CNVYCSPDRW TPVPGAKLEE EVYDEDGNTL QDFALRAGAP
GGGGPRPRWG RCTALYYPPG KRHADGIFSK AYRKLLGQLS ARNYLHSLMA KRVGGASSGL
GDEAEPLSKR HIDGIFTDSY SRYRKQMAVK KYLAAVLGKR YKQRVKNKGR RVAYL


Related products :

Catalog number Product name Quantity
18-783-78064 SHEEP ANTI HUMAN PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE - PACAP-38; PACAP Polyclonal 1 ml
E1347b ELISA ADCYAP1,Bos taurus,Bovine,PACAP,PACAP,Pituitary adenylate cyclase-activating polypeptide 96T
U1347b CLIA ADCYAP1,Bos taurus,Bovine,PACAP,PACAP,Pituitary adenylate cyclase-activating polypeptide 96T
U1347m CLIA Adcyap1,Mouse,Mus musculus,PACAP,Pacap,Pituitary adenylate cyclase-activating polypeptide 96T
E1347m ELISA Adcyap1,Mouse,Mus musculus,PACAP,Pacap,Pituitary adenylate cyclase-activating polypeptide 96T
E1347m ELISA kit Adcyap1,Mouse,Mus musculus,PACAP,Pacap,Pituitary adenylate cyclase-activating polypeptide 96T
E1347b ELISA kit ADCYAP1,Bos taurus,Bovine,PACAP,PACAP,Pituitary adenylate cyclase-activating polypeptide 96T
SCH-7394-9009 SHEEP ANTI HUMAN PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE, Product Type Polyclonal Antibody, Specificity PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE, Target Species Human, Host Sh 1 ml
7394-9009 SHEEP ANTI HUMAN PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE, Product Type Polyclonal Antibody, Specificity PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE, Target Species Human, Host Sh 1 ml
QY-E11471 Rat pituitary adenylate cyclase activating polypeptide(PACAP)ELISA Kit 96T
UB-E11471 Rat pituitary adenylate cyclase activating polypeptide(PACAP)ELISA Kit 96T
201-11-0174 Rat pituitary adenylate cyclase activating polypeptide(PACAP)ELISA Kit 96T
E02P0585 Rat pituitary adenylate cyclase activating polypeptide,PACAP ELISA Kit 96 Tests/kit
E02P0585 Rat Pituitary adenylate cyclase activating polypeptide ELISA , PACAP
YHB0848Ra Rat pituitary adenylate cyclase activating polypeptide,PACAP ELISA Kit 96T
E12411559 Rat Pituitary Adenylate Cyclase Activating Polypeptide(PACAP) ELISA Kit 1
E-EL-R1435 Rat PACAP-38 (Pituitary Adenylate Cyclase Activating Polypeptide 38) ELISA Kit 96T
E0173Ra Rat pituitary adenylate cyclase activating polypeptide,PACAP ELISA Kit 48T
E0173Ra Rat pituitary adenylate cyclase activating polypeptide,PACAP ELISA Kit 96T
YHB0848Ra Rat pituitary adenylate cyclase activating polypeptide,PACAP ELISA Kit 48T
E02P0585 Rat Pituitary adenylate cyclase activating polypeptide ELISA , PACAP 96 Tests/kit
E0172Ra Rat pituitary adenylate cyclase activating polypeptide,PACAP ELISA Kit 48T
201-11-0174 Rat pituitary adenylate cyclase activating polypeptide,PACAP ELISA Kit 96T
E-EL-R1436 Rat PACAP-27 (Pituitary Adenylate Cyclase Activating Polypeptide 27) ELISA Kit 96T
E-EL-Ch2266 Chicken PACAP-27 (Pituitary Adenylate Cyclase Activating Polypeptide 27) ELISA Kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur | Gentaur





GENTAUR Ltd.
Unicorn House, Station Cl
Hertfordshire, Potters Bar EN6 1TL
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017
RIB 30004 00187 00010092253 10
BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG
IBAN FR76 3000 4001 8700 0100 9225 310
france@gentaur.com | Gentaur | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: +49 0241 40 08 90 86, +49 0241 95 78 94 78, +49 0241 40 08 90 86
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur | Gentaur