Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic (EC 2.7.7.27) (ADP-glucose pyrophosphorylase) (ADP-glucose synthase) (AGPase B) (Alpha-D-glucose-1-phosphate adenyl transferase)

 GLGS_HORVU              Reviewed;         513 AA.
P55238;
01-OCT-1996, integrated into UniProtKB/Swiss-Prot.
01-OCT-1996, sequence version 1.
12-SEP-2018, entry version 98.
RecName: Full=Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic;
EC=2.7.7.27;
AltName: Full=ADP-glucose pyrophosphorylase;
AltName: Full=ADP-glucose synthase;
AltName: Full=AGPase B;
AltName: Full=Alpha-D-glucose-1-phosphate adenyl transferase;
Flags: Precursor;
Hordeum vulgare (Barley).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BOP clade;
Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
NCBI_TaxID=4513;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2).
STRAIN=cv. Bomi; TISSUE=Leaf, and Starchy endosperm;
PubMed=8546676; DOI=10.1042/bj3130149;
Thorbjoernsen T., Villand P., Kleczkowski L.A., Olsen O.-A.;
"A single gene encodes two different transcripts for the ADP-glucose
pyrophosphorylase small subunit from barley (Hordeum vulgare).";
Biochem. J. 313:149-154(1996).
[2]
NUCLEOTIDE SEQUENCE [MRNA] OF 285-470.
STRAIN=cv. Bomi; TISSUE=Seed;
PubMed=1320425; DOI=10.1007/BF00023385;
Villand P., Aalen R., Olsen O.-A., Luethi E., Loenneborg A.,
Kleczkowski L.A.;
"PCR amplification and sequences of cDNA clones for the small and
large subunits of ADP-glucose pyrophosphorylase from barley tissues.";
Plant Mol. Biol. 19:381-389(1992).
-!- FUNCTION: This protein plays a role in synthesis of starch. It
catalyzes the synthesis of the activated glycosyl donor, ADP-
glucose from Glc-1-P and ATP.
-!- CATALYTIC ACTIVITY: ATP + alpha-D-glucose 1-phosphate =
diphosphate + ADP-glucose.
-!- ACTIVITY REGULATION: Activated by 3'phosphoglycerate, inhibited by
orthophosphate. Allosteric regulation.
-!- PATHWAY: Glycan biosynthesis; starch biosynthesis.
-!- SUBUNIT: Heterotetramer.
-!- SUBCELLULAR LOCATION: Plastid, chloroplast. Plastid, amyloplast.
Note=Found in the chloroplast in leaf. Found in the plastid in the
developing endosperm.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P55238-1; Sequence=Displayed;
Name=2; Synonyms=BEPSF1;
IsoId=P55238-2; Sequence=VSP_001752;
-!- TISSUE SPECIFICITY: Leaves and starchy endosperm.
-!- SIMILARITY: Belongs to the bacterial/plant glucose-1-phosphate
adenylyltransferase family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; Z48563; CAA88450.1; -; mRNA.
EMBL; Z48562; CAA88449.1; -; mRNA.
EMBL; Z48578; CAA88462.1; -; Genomic_DNA.
EMBL; Z48578; CAA88461.1; -; Genomic_DNA.
EMBL; X62241; -; NOT_ANNOTATED_CDS; mRNA.
PIR; S22524; S22524.
PIR; S61478; S61478.
PIR; S61479; S61479.
UniGene; Hv.3227; -.
ProteinModelPortal; P55238; -.
SMR; P55238; -.
eggNOG; ENOG410IMYM; Eukaryota.
eggNOG; COG0448; LUCA.
SABIO-RK; P55238; -.
UniPathway; UPA00152; -.
ExpressionAtlas; P55238; baseline and differential.
GO; GO:0009501; C:amyloplast; IEA:UniProtKB-SubCell.
GO; GO:0009507; C:chloroplast; IEA:UniProtKB-SubCell.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0008878; F:glucose-1-phosphate adenylyltransferase activity; IEA:UniProtKB-EC.
GO; GO:0005978; P:glycogen biosynthetic process; IEA:InterPro.
GO; GO:0019252; P:starch biosynthetic process; IEA:UniProtKB-UniPathway.
Gene3D; 3.90.550.10; -; 1.
InterPro; IPR011831; ADP-Glc_PPase.
InterPro; IPR005836; ADP_Glu_pyroP_CS.
InterPro; IPR005835; NTP_transferase_dom.
InterPro; IPR029044; Nucleotide-diphossugar_trans.
InterPro; IPR011004; Trimer_LpxA-like_sf.
Pfam; PF00483; NTP_transferase; 1.
SUPFAM; SSF51161; SSF51161; 1.
SUPFAM; SSF53448; SSF53448; 2.
TIGRFAMs; TIGR02091; glgC; 1.
PROSITE; PS00808; ADP_GLC_PYROPHOSPH_1; 1.
PROSITE; PS00809; ADP_GLC_PYROPHOSPH_2; 1.
PROSITE; PS00810; ADP_GLC_PYROPHOSPH_3; 1.
2: Evidence at transcript level;
Allosteric enzyme; Alternative splicing; Amyloplast; ATP-binding;
Chloroplast; Nucleotide-binding; Nucleotidyltransferase; Plastid;
Starch biosynthesis; Transferase; Transit peptide.
TRANSIT 1 64 Chloroplast. {ECO:0000255}.
CHAIN 65 513 Glucose-1-phosphate adenylyltransferase
small subunit,
chloroplastic/amyloplastic.
/FTId=PRO_0000011152.
VAR_SEQ 1 81 MAMAAAASPSKILIPPHRASAVTAAASTSCDSLRLLCAPRG
RPGPRGLVARPVPRRPFFFSPRAVSDSKSSQTCLDPDAST
-> MDVPLASKVPLPSPSKHEQCNVYSHKSSSKHADLNPHA
ID (in isoform 2).
{ECO:0000303|PubMed:8546676}.
/FTId=VSP_001752.
CONFLICT 285 286 EM -> KY (in Ref. 2; X62241).
{ECO:0000305}.
CONFLICT 291 291 S -> G (in Ref. 2; X62241).
{ECO:0000305}.
CONFLICT 426 426 T -> A (in Ref. 2; X62241).
{ECO:0000305}.
SEQUENCE 513 AA; 56049 MW; 2314BFB79D521818 CRC64;
MAMAAAASPS KILIPPHRAS AVTAAASTSC DSLRLLCAPR GRPGPRGLVA RPVPRRPFFF
SPRAVSDSKS SQTCLDPDAS TSVLGIILGG GAGTRLYPLT KKRAKPAVPL GANYRLIDIP
VSNCLNSNIS KIYVLTQFNS ASLNRHLSRA YGSNIGGYKN EGFVEVLAAQ QSPDNPDWFQ
GTADAVRQYL WLFEEHNVME YLILAGDHLY RMDYEKFIQA HRETDADITV AALPMDEERA
TAFGLMKIDE EGRIIEFAEK PKGEQLKAMM VDTTILGLED ARAKEMPYIA SMGIYVISKH
VMLQLLREQF PGANDFGSEV IPGATSTGMR VQAYLYDGYW EDIGTIEAFY NANLGITKKP
IPDFSFYDRS APIYTQPRHL PPSKVLDADV TDSVIGEGCV IKNCKIHHSV VGLRSCISEG
AIIEDTLLMG ADYYETEADK KLLAEKGGIP IGIGKNSHIK RAIIDKNARI GDNVMIINVD
NVQEAARETD GYFIKSGIVT VIKDALLPSG TVI


Related products :

Catalog number Product name Quantity
25-939 G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum.It forms with the glucose-6-phosphate transporter (SLC37A4_G6PT) the complex responsible for glucose production through glyc 0.05 mg
EIAAB45288 Pig,Sus scrofa,UDP-glucose pyrophosphorylase,UDPGP,UGP2,UGPase,UTP--glucose-1-phosphate uridylyltransferase
EIAAB45286 Bos taurus,Bovine,UDP-glucose pyrophosphorylase,UDPGP,UGP2,UGPase,UTP--glucose-1-phosphate uridylyltransferase
EIAAB45289 Mouse,Mus musculus,UDP-glucose pyrophosphorylase,UDPGP,Ugp2,UGPase,UTP--glucose-1-phosphate uridylyltransferase
AS11 1739 Antibody: ADGP | ADP-glucose pyrophosphorylase, Immunogen: KLH-conjugated synthetic peptide derived from know sequences of small and large subunit of ADP-glucose pyrophosphorylase including Arabidopsi 200
EIAAB45287 Homo sapiens,Human,UDP-glucose pyrophosphorylase,UDPGP,UGP1,UGP2,UGPase,UTP--glucose-1-phosphate uridylyltransferase
25-895 SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogen 0.05 mg
26-846 Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes t 0.05 mg
30-393 UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissu 0.05 mg
30-412 Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosp 0.05 mg
AO1162a Glucose-6-phosphate isomerase Antibody Mouse Monoclonal Antiobdy to Glucose-6-phosphate isomerase Applications WB, IF, E 0.1ml
DL-GPI-Ra Rat Glucose 6 Phosphate Isomerase (GPI) ELISA KitAMF,Autocrine motility factor,Glucose-6-phosphate isomerase,GPI,Gpi,Neuroleukin,NLK,PGI,PHI,Phosphoglucose isomerase,Phosphohexose isomerase 96T
DL-AMF-Ra Rat Glucose 6 Phosphate Isomerase (GPI) ELISA KitAMF,Autocrine motility factor,Glucose-6-phosphate isomerase,GPI,Gpi,Neuroleukin,NLK,PGI,PHI,Phosphoglucose isomerase,Phosphohexose isomerase 96T
GLUCOSE Liquid stable, Glucose oxidase_Peroxidase method for the determination of glucose in serum, plasma and CSF 2x150 ml
20-783-73301 MOUSE ANTI ASPERGILLUS SPP. GLUCOSE OXIDASE - EC 1.1.3.4; Glucose oxyhydrase; GOD; Beta-D-glucose oxygen 1-oxido-reductase Monoclonal 1 mg
71662-16-3 glucose 1_(barium phosphate) glucose 1_(barium phos 1g
TM 324 TM 324 GLUCOSE PHOSPHATE BROTH (BUFFERED GLUCOSE BROTH) (MR_VP MEDIUM) (used in differentiation of bacteria by MR_VP test) 100 gm
TM 324 TM 324 GLUCOSE PHOSPHATE BROTH (BUFFERED GLUCOSE BROTH) (MR_VP MEDIUM) (used in differentiation of bacteria by MR_VP test) 500 gm
E1185h ELISA Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185h ELISA kit Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U1185h CLIA Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
71662-13-0 a-D-Glucose 1,6-bisphosphate tetra(cycl alpha-D-Glucose-1,6-di 1g
6736-77-2 glucose 1_(dipotassium phosphate) glucose 1_(dipotassium 1g
15912-94-4 glucose 6_(calcium phosphate) glucose 6_(calcium pho 1g
298-65701 Glucose Assay With the LabAssay Glucose Assay, when a sample is mixed with the Choromogen Reagent, the alpha_form of glucose in the sample is converted to beta_form by mutarotase. beta_DGlucose is oxi 1,000 tests


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur