Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Glutamate carboxypeptidase 2 (EC 3.4.17.21) (Cell growth-inhibiting gene 27 protein) (Folate hydrolase 1) (Folylpoly-gamma-glutamate carboxypeptidase) (FGCP) (Glutamate carboxypeptidase II) (GCPII) (Membrane glutamate carboxypeptidase) (mGCP) (N-acetylated-alpha-linked acidic dipeptidase I) (NAALADase I) (Prostate-specific membrane antigen) (PSM) (PSMA) (Pteroylpoly-gamma-glutamate carboxypeptidase)

 FOLH1_HUMAN             Reviewed;         750 AA.
Q04609; A4UU12; A9CB79; B7Z312; B7Z343; D3DQS5; E9PDX8; O43748;
Q16305; Q541A4; Q8TAY3; Q9NP15; Q9NYE2; Q9P1P8;
01-JUN-1994, integrated into UniProtKB/Swiss-Prot.
01-JUN-1994, sequence version 1.
25-OCT-2017, entry version 189.
RecName: Full=Glutamate carboxypeptidase 2;
EC=3.4.17.21;
AltName: Full=Cell growth-inhibiting gene 27 protein;
AltName: Full=Folate hydrolase 1;
AltName: Full=Folylpoly-gamma-glutamate carboxypeptidase;
Short=FGCP;
AltName: Full=Glutamate carboxypeptidase II;
Short=GCPII;
AltName: Full=Membrane glutamate carboxypeptidase;
Short=mGCP;
AltName: Full=N-acetylated-alpha-linked acidic dipeptidase I;
Short=NAALADase I;
AltName: Full=Prostate-specific membrane antigen;
Short=PSM;
Short=PSMA;
AltName: Full=Pteroylpoly-gamma-glutamate carboxypeptidase;
Name=FOLH1; Synonyms=FOLH, NAALAD1, PSM, PSMA; ORFNames=GIG27;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSMA-1), AND PARTIAL PROTEIN
SEQUENCE.
TISSUE=Prostatic carcinoma;
PubMed=8417812;
Israeli R.S., Powell C.T., Fair W.R., Heston W.D.W.;
"Molecular cloning of a complementary DNA encoding a prostate-specific
membrane antigen.";
Cancer Res. 53:227-230(1993).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSMA').
TISSUE=Prostate;
PubMed=7882349;
Su S.L., Huang I.-P., Fair W.R., Powell C.T., Heston W.D.W.;
"Alternatively spliced variants of prostate-specific membrane antigen
RNA: ratio of expression as a potential measurement of progression.";
Cancer Res. 55:1441-1443(1995).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM PSMA-1), AND VARIANT
HIS-75.
PubMed=9838072; DOI=10.1016/S0167-4781(98)00200-0;
O'Keefe D.S., Su S.L., Bacich D.J., Horiguchi Y., Luo Y., Powell C.T.,
Zandvliet D., Russell P.J., Molloy P.L., Nowak N.J., Shows T.B.,
Mullins C., Vonder Haar R.A., Fair W.R., Heston W.D.W.;
"Mapping, genomic organization and promoter analysis of the human
prostate-specific membrane antigen gene.";
Biochim. Biophys. Acta 1443:113-127(1998).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSMA-1).
TISSUE=Brain;
PubMed=9694964;
Luthi-Carter R., Barczak A.K., Speno H., Coyle J.T.;
"Molecular characterization of human brain N-acetylated alpha-linked
acidic dipeptidase (NAALADase).";
J. Pharmacol. Exp. Ther. 286:1020-1025(1998).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSMA-1), AND CHARACTERIZATION.
TISSUE=Prostate;
PubMed=10085079; DOI=10.1074/jbc.274.13.8470;
Pangalos M.N., Neefs J.-M., Somers M., Verhasselt P., Bekkers M.,
van der Helm L., Fraiponts E., Ashton D., Gordon R.D.;
"Isolation and expression of novel human glutamate carboxypeptidases
with N-acetylated alpha-linked acidic dipeptidase and dipeptidyl
peptidase IV activity.";
J. Biol. Chem. 274:8470-8483(1999).
[6]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSMA-1), VARIANT TYR-475, AND
TISSUE SPECIFICITY.
TISSUE=Jejunum, and Small intestine;
PubMed=11092759; DOI=10.1093/hmg/9.19.2837;
Devlin A.M., Ling E.-H., Peerson J.M., Fernando S., Clarke R.,
Smith A.D., Halsted C.H.;
"Glutamate carboxypeptidase II: a polymorphism associated with lower
levels of serum folate and hyperhomocysteinemia.";
Hum. Mol. Genet. 9:2837-2844(2000).
[7]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSMA-1).
TISSUE=Prostatic carcinoma;
Ye C.Z., Zhang F.L., Zhang Y.K., Chen C.Q.;
"Cloning and sequencing of Chinese prostate-specific membrane
antigen.";
Mian Yi Xue Za Zhi 17:328-330(2001).
[8]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSMA-9).
PubMed=17929272; DOI=10.1002/pros.20664;
Cao K.Y., Mao X.P., Wang D.H., Xu L., Yuan G.Q., Dai S.Q., Zheng B.J.,
Qiu S.P.;
"High expression of PSM-E correlated with tumor grade in prostate
cancer: a new alternatively spliced variant of prostate-specific
membrane antigen.";
Prostate 67:1791-1800(2007).
[9]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Peace D.J., Zhang Y., Holt G., Ferrer K.T., Heller M., Sosman J.A.,
Xue B.H.;
"Identification of three novel splice variants of prostate-specific
membrane antigen.";
Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSMA-8).
Kim J.W., Kim H.K., Shin S.M.;
"Identification of a cell growth-inhibiting gene.";
Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
[11]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS PSMA-1; PSMA-7 AND
10).
TISSUE=Amygdala, Corpus callosum, and Hippocampus;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[12]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16554811; DOI=10.1038/nature04632;
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K.,
Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F.,
Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E.,
FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S.,
Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W.,
Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S.,
Sakaki Y.;
"Human chromosome 11 DNA sequence and analysis including novel gene
identification.";
Nature 440:497-500(2006).
[13]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[14]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PSMA-8).
TISSUE=Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[15]
PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSMA-3), AND TISSUE
SPECIFICITY.
TISSUE=Prostate;
PubMed=9375657;
Bzdega T., Turi T., Wroblewska B., She D., Chung H.S., Kim H.,
Neale J.H.;
"Molecular cloning of a peptidase against N-acetylaspartylglutamate
from a rat hippocampal cDNA library.";
J. Neurochem. 69:2270-2277(1997).
[16]
PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PSMA-4).
Lupold S.E., Criley S.C., Coffey D.S.;
"Alternative splicing of the prostate-specific membrane antigen.";
Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases.
[17]
PROTEIN SEQUENCE OF 60-74, AND SUBCELLULAR LOCATION.
TISSUE=Prostatic carcinoma;
PubMed=9809977;
Grauer L.S., Lawler K.D., Marignac J.L., Kumar A., Goel A.S.,
Wolfert R.L.;
"Identification, purification, and subcellular localization of
prostate-specific membrane antigen PSM' protein in the LNCaP prostatic
carcinoma cell line.";
Cancer Res. 58:4787-4789(1998).
[18]
ALTERNATIVE SPLICING.
Bzdega T., She D., Turi T., Wroblewska B., Neale J.H.;
"Molecular cloning of alternatively spliced variants of the peptidase
against N-acetylaspartylglutamate (NAAG) from human and rat nervous
systems.";
Abstr. - Soc. Neurosci. 24:579-579(1998).
[19]
CHARACTERIZATION.
PubMed=9622670; DOI=10.1016/S0006-8993(98)00244-3;
Luthi-Carter R., Barczak A.K., Speno H.D., Coyle J.T.;
"Hydrolysis of the neuropeptide N-acetylaspartylglutamate (NAAG) by
cloned human glutamate carboxypeptidase II.";
Brain Res. 795:341-348(1998).
[20]
DOMAIN STRUCTURE.
PubMed=9187245; DOI=10.1016/S0167-4838(97)00008-3;
Rawlings N.D., Barrett A.J.;
"Structure of membrane glutamate carboxypeptidase.";
Biochim. Biophys. Acta 1339:247-252(1997).
[21]
MUTAGENESIS.
PubMed=9882712;
Speno H.S., Luthi-Carter R., Macias W.L., Valentine S.L.,
Joshi A.R.T., Coyle J.T.;
"Site-directed mutagenesis of predicted active site residues in
glutamate carboxypeptidase II.";
Mol. Pharmacol. 55:179-185(1999).
[22]
GLYCOSYLATION AT ASN-76; ASN-336; ASN-459; ASN-476 AND ASN-638.
PubMed=12754519; DOI=10.1038/nbt827;
Zhang H., Li X.-J., Martin D.B., Aebersold R.;
"Identification and quantification of N-linked glycoproteins using
hydrazide chemistry, stable isotope labeling and mass spectrometry.";
Nat. Biotechnol. 21:660-666(2003).
[23]
GLYCOSYLATION AT ASN-51; ASN-76; ASN-121; ASN-140; ASN-153; ASN-195;
ASN-336; ASN-459; ASN-476 AND ASN-638, AND MUTAGENESIS OF ASN-51;
ASN-76; ASN-121; ASN-140; ASN-153; ASN-195; ASN-336; ASN-459; ASN-476;
ASN-638 AND THR-640.
PubMed=15152093; DOI=10.1110/ps.04622104;
Barinka C., Sacha P., Sklenar J., Man P., Bezouska K., Slusher B.S.,
Konvalinka J.;
"Identification of the N-glycosylation sites on glutamate
carboxypeptidase II necessary for proteolytic activity.";
Protein Sci. 13:1627-1635(2004).
[24]
TISSUE SPECIFICITY.
TISSUE=Liver;
PubMed=14716746; DOI=10.1002/pros.10319;
O'Keefe D.S., Bacich D.J., Heston W.D.W.;
"Comparative analysis of prostate-specific membrane antigen (PSMA)
versus a prostate-specific membrane antigen-like gene.";
Prostate 58:200-210(2004).
[25]
TISSUE SPECIFICITY.
PubMed=16555021; DOI=10.1007/s00268-005-0544-5;
Kinoshita Y., Kuratsukuri K., Landas S., Imaida K., Rovito P.M. Jr.,
Wang C.Y., Haas G.P.;
"Expression of prostate-specific membrane antigen in normal and
malignant human tissues.";
World J. Surg. 30:628-636(2006).
[26]
TISSUE SPECIFICITY.
PubMed=17150306; DOI=10.1016/j.neuroscience.2006.10.022;
Sacha P., Zamecnik J., Barinka C., Hlouchova K., Vicha A.,
Mlcochova P., Hilgert I., Eckschlager T., Konvalinka J.;
"Expression of glutamate carboxypeptidase II in human brain.";
Neuroscience 144:1361-1372(2007).
[27]
X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 44-750 IN COMPLEXES WITH
GLUTAMATE; INHIBITORS; CALCIUM AND ZINC IONS, COFACTOR, SUBUNIT, AND
GLYCOSYLATION AT ASN-76; ASN-121; ASN-140; ASN-195; ASN-459; ASN-476
AND ASN-638.
PubMed=16467855; DOI=10.1038/sj.emboj.7600969;
Mesters J.R., Barinka C., Li W., Tsukamoto T., Majer P., Slusher B.S.,
Konvalinka J., Hilgenfeld R.;
"Structure of glutamate carboxypeptidase II, a drug target in neuronal
damage and prostate cancer.";
EMBO J. 25:1375-1384(2006).
[28]
X-RAY CRYSTALLOGRAPHY (2.19 ANGSTROMS) OF 44-750 IN COMPLEXES WITH THE
INHIBITORS QUISQUALATE AND 2-PMPA; CALCIUM AND ZINC IONS, AND
GLYCOSYLATION AT ASN-76; ASN-121; ASN-140; ASN-195; ASN-459; ASN-476
AND ASN-638.
PubMed=17372356; DOI=10.1107/S090744490700902X;
Mesters J.R., Henning K., Hilgenfeld R.;
"Human glutamate carboxypeptidase II inhibition: structures of GCPII
in complex with two potent inhibitors, quisqualate and 2-PMPA.";
Acta Crystallogr. D 63:508-513(2007).
[29]
X-RAY CRYSTALLOGRAPHY (1.62 ANGSTROMS) OF 44-750 IN COMPLEXES WITH
SUBSTRATE ANALOGS; CALCIUM AND ZINC IONS, ENZYME REGULATION, AND
GLYCOSYLATION AT ASN-76; ASN-121; ASN-140 ASN-195; ASN-459; ASN-476
AND ASN-638.
PubMed=17567119; DOI=10.1021/jm070133w;
Barinka C., Rovenska M., Mlcochova P., Hlouchova K., Plechanovova A.,
Majer P., Tsukamoto T., Slusher B.S., Konvalinka J., Lubkowski J.;
"Structural insight into the pharmacophore pocket of human glutamate
carboxypeptidase II.";
J. Med. Chem. 50:3267-3273(2007).
[30]
X-RAY CRYSTALLOGRAPHY (1.54 ANGSTROMS) OF 44-750 IN COMPLEXES WITH
UREA-BASED INHIBITORS; CALCIUM AND ZINC IONS, AND GLYCOSYLATION AT
ASN-76; ASN-121; ASN-140; ASN-195; ASN-459; ASN-476 AND ASN-638.
PubMed=19053759; DOI=10.1021/jm800765e;
Barinka C., Byun Y., Dusich C.L., Banerjee S.R., Chen Y.,
Castanares M., Kozikowski A.P., Mease R.C., Pomper M.G., Lubkowski J.;
"Interactions between human glutamate carboxypeptidase II and urea-
based inhibitors: structural characterization.";
J. Med. Chem. 51:7737-7743(2008).
[31]
X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 44-750 IN COMPLEXES WITH
SUBSTRATE ANALOGS; CALCIUM AND ZINC IONS, AND GLYCOSYLATION AT ASN-76;
ASN-121; ASN-140; ASN-195; ASN-459; ASN-476 AND ASN-638.
PubMed=18234225; DOI=10.1016/j.jmb.2007.12.066;
Barinka C., Hlouchova K., Rovenska M., Majer P., Dauter M., Hin N.,
Ko Y.-S., Tsukamoto T., Slusher B.S., Konvalinka J., Lubkowski J.;
"Structural basis of interactions between human glutamate
carboxypeptidase II and its substrate analogs.";
J. Mol. Biol. 376:1438-1450(2008).
[32]
X-RAY CRYSTALLOGRAPHY (1.71 ANGSTROMS) OF 44-750 IN COMPLEX WITH
SUBSTRATE; CALCIUM AND ZINC IONS, GLYCOSYLATION AT ASN-76; ASN-121;
ASN-140; ASN-195; ASN-459; ASN-476 AND ASN-638, AND MUTAGENESIS OF
GLU-424.
PubMed=19301871; DOI=10.1021/bi900220s;
Klusak V., Barinka C., Plechanovova A., Mlcochova P., Konvalinka J.,
Rulisek L., Lubkowski J.;
"Reaction mechanism of glutamate carboxypeptidase II revealed by
mutagenesis, X-ray crystallography, and computational methods.";
Biochemistry 48:4126-4138(2009).
[33]
VARIANT [LARGE SCALE ANALYSIS] THR-23.
PubMed=16959974; DOI=10.1126/science.1133427;
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
Vogelstein B., Kinzler K.W., Velculescu V.E.;
"The consensus coding sequences of human breast and colorectal
cancers.";
Science 314:268-274(2006).
-!- FUNCTION: Has both folate hydrolase and N-acetylated-alpha-linked-
acidic dipeptidase (NAALADase) activity. Has a preference for tri-
alpha-glutamate peptides. In the intestine, required for the
uptake of folate. In the brain, modulates excitatory
neurotransmission through the hydrolysis of the neuropeptide, N-
aceylaspartylglutamate (NAAG), thereby releasing glutamate.
Involved in prostate tumor progression.
-!- FUNCTION: Also exhibits a dipeptidyl-peptidase IV type activity.
In vitro, cleaves Gly-Pro-AMC.
-!- CATALYTIC ACTIVITY: Release of an unsubstituted, C-terminal
glutamyl residue, typically from Ac-Asp-Glu or folylpoly-gamma-
glutamates.
-!- COFACTOR:
Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
Evidence={ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356, ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225, ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871};
Note=Binds 2 Zn(2+) ions per subunit. Required for NAALADase
activity. {ECO:0000269|PubMed:16467855};
-!- ENZYME REGULATION: The NAALADase activity is inhibited by beta-
NAAG, quisqualic acid, 2-(phosphonomethyl) pentanedioic acid
(PMPA) and EDTA. Activated by cobalt.
{ECO:0000269|PubMed:17567119}.
-!- BIOPHYSICOCHEMICAL PROPERTIES:
pH dependence:
Stable at pH greater than 6.5.;
-!- SUBUNIT: Homodimer. {ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:19301871}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:9809977};
Single-pass type II membrane protein {ECO:0000269|PubMed:9809977}.
-!- SUBCELLULAR LOCATION: Isoform PSMA': Cytoplasm
{ECO:0000269|PubMed:9809977}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=8;
Name=PSMA-1;
IsoId=Q04609-1; Sequence=Displayed;
Note=No experimental confirmation available.;
Name=PSMA-3;
IsoId=Q04609-3; Sequence=VSP_040242, VSP_040245;
Note=No experimental confirmation available. Incomplete
sequence.;
Name=PSMA-4;
IsoId=Q04609-4; Sequence=VSP_040241, VSP_040243, VSP_040244;
Note=No experimental confirmation available. Incomplete
sequence.;
Name=PSMA';
IsoId=Q04609-6; Sequence=VSP_005336;
Name=PSMA-7;
IsoId=Q04609-7; Sequence=VSP_038058;
Name=PSMA-8;
IsoId=Q04609-8; Sequence=VSP_038059;
Name=PSMA-9; Synonyms=PSM-E;
IsoId=Q04609-9; Sequence=VSP_038058, VSP_038059;
Name=10;
IsoId=Q04609-10; Sequence=VSP_044287;
-!- TISSUE SPECIFICITY: Highly expressed in prostate epithelium.
Detected in urinary bladder, kidney, testis, ovary, fallopian
tube, breast, adrenal gland, liver, esophagus, stomach, small
intestine, colon and brain (at protein level). Detected in the
small intestine, brain, kidney, liver, spleen, colon, trachea,
spinal cord and the capillary endothelium of a variety of tumors.
Expressed specifically in jejunum brush border membranes. In the
brain, highly expressed in the ventral striatum and brain stem.
Also expressed in fetal liver and kidney. Isoform PSMA' is the
most abundant form in normal prostate. Isoform PSMA-1 is the most
abundant form in primary prostate tumors. Isoform PSMA-3 is also
found in normal prostate as well as in brain and liver. Isoform
PSMA-9 is specifically expressed in prostate cancer.
{ECO:0000269|PubMed:11092759, ECO:0000269|PubMed:14716746,
ECO:0000269|PubMed:16555021, ECO:0000269|PubMed:17150306,
ECO:0000269|PubMed:9375657}.
-!- INDUCTION: In the prostate, up-regulated in response to androgen
deprivation.
-!- DOMAIN: The NAALADase activity is found in the central region, the
dipeptidyl peptidase IV type activity in the C-terminal.
{ECO:0000269|PubMed:9187245}.
-!- PTM: The first two amino acids at the N-terminus of isoform PSMA'
appear to be cleaved by limited proteolysis.
-!- PTM: The N-terminus is blocked.
-!- POLYMORPHISM: Genetic variation in FOLH1 may be associated with
low folate levels and consequent hyperhomocysteinemia. This
condition can result in increased risk of cardiovascular disease,
neural tube defects, and cognitive deficits.
-!- MISCELLANEOUS: PSMA is used as a diagnostic and prognostic
indicator of prostate cancer, and as a possible marker for various
neurological disorders such as schizophrenia, Alzheimer disease
and Huntington disease.
-!- SIMILARITY: Belongs to the peptidase M28 family. M28B subfamily.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAF31167.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; M99487; AAA60209.1; -; mRNA.
EMBL; S76978; AAB33750.2; -; mRNA.
EMBL; AF007544; AAC83972.1; -; Genomic_DNA.
EMBL; AF176574; AAD51121.1; -; mRNA.
EMBL; EF488811; ABO93402.2; -; mRNA.
EMBL; AY101595; AAM34479.1; -; mRNA.
EMBL; AF107214; AAF31167.1; ALT_SEQ; Genomic_DNA.
EMBL; DQ088979; AAZ66619.1; -; mRNA.
EMBL; AK312366; BAG35284.1; -; mRNA.
EMBL; AK295368; BAH12048.1; -; mRNA.
EMBL; AK295470; BAH12079.1; -; mRNA.
EMBL; AC110742; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC118273; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471064; EAW67858.1; -; Genomic_DNA.
EMBL; CH471064; EAW67861.1; -; Genomic_DNA.
EMBL; CH471064; EAW67857.1; -; Genomic_DNA.
EMBL; CH471064; EAW67859.1; -; Genomic_DNA.
EMBL; BC025672; AAH25672.1; -; mRNA.
EMBL; AF254358; AAF71358.1; -; mRNA.
EMBL; AF254357; AAF71357.1; -; mRNA.
CCDS; CCDS31493.1; -. [Q04609-8]
CCDS; CCDS53626.1; -. [Q04609-10]
CCDS; CCDS53627.1; -. [Q04609-9]
CCDS; CCDS53628.1; -. [Q04609-7]
CCDS; CCDS7946.1; -. [Q04609-1]
PIR; A56881; A56881.
RefSeq; NP_001014986.1; NM_001014986.1. [Q04609-8]
RefSeq; NP_001180400.1; NM_001193471.1. [Q04609-7]
RefSeq; NP_001180401.1; NM_001193472.1. [Q04609-9]
RefSeq; NP_001180402.1; NM_001193473.1. [Q04609-10]
RefSeq; NP_004467.1; NM_004476.1. [Q04609-1]
RefSeq; XP_016872923.1; XM_017017434.1. [Q04609-7]
RefSeq; XP_016872924.1; XM_017017435.1. [Q04609-9]
RefSeq; XP_016872925.1; XM_017017436.1. [Q04609-6]
RefSeq; XP_016872926.1; XM_017017437.1. [Q04609-6]
RefSeq; XP_016872931.1; XM_017017442.1. [Q04609-6]
RefSeq; XP_016872932.1; XM_017017443.1. [Q04609-6]
RefSeq; XP_016872933.1; XM_017017444.1. [Q04609-10]
RefSeq; XP_016872934.1; XM_017017445.1. [Q04609-10]
RefSeq; XP_016872935.1; XM_017017446.1. [Q04609-10]
RefSeq; XP_016872936.1; XM_017017447.1. [Q04609-10]
RefSeq; XP_016872937.1; XM_017017448.1. [Q04609-10]
UniGene; Hs.551896; -.
UniGene; Hs.645352; -.
UniGene; Hs.654487; -.
PDB; 1Z8L; X-ray; 3.50 A; A/B/C/D=56-750.
PDB; 2C6C; X-ray; 2.00 A; A=44-750.
PDB; 2C6G; X-ray; 2.20 A; A=44-750.
PDB; 2C6P; X-ray; 2.39 A; A=44-750.
PDB; 2CIJ; X-ray; 2.40 A; A=44-750.
PDB; 2JBJ; X-ray; 2.19 A; A=44-750.
PDB; 2JBK; X-ray; 2.99 A; A=44-750.
PDB; 2OOT; X-ray; 1.64 A; A=44-750.
PDB; 2OR4; X-ray; 1.62 A; A=44-750.
PDB; 2PVV; X-ray; 2.11 A; A=44-750.
PDB; 2PVW; X-ray; 1.71 A; A=44-750.
PDB; 2XEF; X-ray; 1.59 A; A=44-750.
PDB; 2XEG; X-ray; 1.59 A; A=44-750.
PDB; 2XEI; X-ray; 1.69 A; A=44-750.
PDB; 2XEJ; X-ray; 1.78 A; A=44-750.
PDB; 3BHX; X-ray; 1.60 A; A=44-750.
PDB; 3BI0; X-ray; 1.67 A; A=44-750.
PDB; 3BI1; X-ray; 1.50 A; A=44-750.
PDB; 3BXM; X-ray; 1.71 A; A=44-750.
PDB; 3D7D; X-ray; 1.69 A; A=44-750.
PDB; 3D7F; X-ray; 1.54 A; A=44-750.
PDB; 3D7G; X-ray; 1.75 A; A=44-750.
PDB; 3D7H; X-ray; 1.55 A; A=44-750.
PDB; 3IWW; X-ray; 2.30 A; A=44-750.
PDB; 3RBU; X-ray; 1.60 A; A=44-750.
PDB; 3SJE; X-ray; 1.70 A; A=44-750.
PDB; 3SJF; X-ray; 1.65 A; A=44-750.
PDB; 3SJG; X-ray; 1.65 A; A=44-750.
PDB; 3SJX; X-ray; 1.66 A; A=44-750.
PDB; 4JYW; X-ray; 1.73 A; A=44-750.
PDB; 4JZ0; X-ray; 1.83 A; A=44-750.
PDB; 4LQG; X-ray; 1.77 A; A=44-750.
PDB; 4MCP; X-ray; 1.65 A; A=44-750.
PDB; 4MCQ; X-ray; 2.00 A; A=44-750.
PDB; 4MCR; X-ray; 1.65 A; A=44-750.
PDB; 4MCS; X-ray; 1.83 A; A=44-750.
PDB; 4NGM; X-ray; 1.84 A; A=44-750.
PDB; 4NGN; X-ray; 1.64 A; A=44-750.
PDB; 4NGP; X-ray; 1.63 A; A=44-750.
PDB; 4NGQ; X-ray; 2.08 A; A=44-750.
PDB; 4NGR; X-ray; 1.90 A; A=44-750.
PDB; 4NGS; X-ray; 1.68 A; A=44-750.
PDB; 4NGT; X-ray; 2.31 A; A=44-750.
PDB; 4OC0; X-ray; 1.85 A; A=44-750.
PDB; 4OC1; X-ray; 1.75 A; A=44-750.
PDB; 4OC2; X-ray; 1.65 A; A=44-750.
PDB; 4OC3; X-ray; 1.79 A; A=44-750.
PDB; 4OC4; X-ray; 1.66 A; A=44-750.
PDB; 4OC5; X-ray; 1.70 A; A=44-750.
PDB; 4OME; X-ray; 1.79 A; A=44-750.
PDB; 4P44; X-ray; 1.75 A; A=44-750.
PDB; 4P45; X-ray; 1.87 A; A=44-750.
PDB; 4P4B; X-ray; 1.93 A; A=44-750.
PDB; 4P4D; X-ray; 1.65 A; A=44-750.
PDB; 4P4E; X-ray; 1.67 A; A=44-750.
PDB; 4P4F; X-ray; 1.86 A; A=44-750.
PDB; 4P4I; X-ray; 1.87 A; A=44-750.
PDB; 4P4J; X-ray; 1.66 A; A=44-750.
PDB; 4W9Y; X-ray; 1.64 A; A=44-750.
PDB; 4X3R; X-ray; 1.86 A; A=44-750.
PDB; 5D29; X-ray; 1.80 A; A=56-750.
PDB; 5ELY; X-ray; 1.81 A; A=55-750.
PDB; 5F09; X-ray; 1.85 A; A=44-750.
PDBsum; 1Z8L; -.
PDBsum; 2C6C; -.
PDBsum; 2C6G; -.
PDBsum; 2C6P; -.
PDBsum; 2CIJ; -.
PDBsum; 2JBJ; -.
PDBsum; 2JBK; -.
PDBsum; 2OOT; -.
PDBsum; 2OR4; -.
PDBsum; 2PVV; -.
PDBsum; 2PVW; -.
PDBsum; 2XEF; -.
PDBsum; 2XEG; -.
PDBsum; 2XEI; -.
PDBsum; 2XEJ; -.
PDBsum; 3BHX; -.
PDBsum; 3BI0; -.
PDBsum; 3BI1; -.
PDBsum; 3BXM; -.
PDBsum; 3D7D; -.
PDBsum; 3D7F; -.
PDBsum; 3D7G; -.
PDBsum; 3D7H; -.
PDBsum; 3IWW; -.
PDBsum; 3RBU; -.
PDBsum; 3SJE; -.
PDBsum; 3SJF; -.
PDBsum; 3SJG; -.
PDBsum; 3SJX; -.
PDBsum; 4JYW; -.
PDBsum; 4JZ0; -.
PDBsum; 4LQG; -.
PDBsum; 4MCP; -.
PDBsum; 4MCQ; -.
PDBsum; 4MCR; -.
PDBsum; 4MCS; -.
PDBsum; 4NGM; -.
PDBsum; 4NGN; -.
PDBsum; 4NGP; -.
PDBsum; 4NGQ; -.
PDBsum; 4NGR; -.
PDBsum; 4NGS; -.
PDBsum; 4NGT; -.
PDBsum; 4OC0; -.
PDBsum; 4OC1; -.
PDBsum; 4OC2; -.
PDBsum; 4OC3; -.
PDBsum; 4OC4; -.
PDBsum; 4OC5; -.
PDBsum; 4OME; -.
PDBsum; 4P44; -.
PDBsum; 4P45; -.
PDBsum; 4P4B; -.
PDBsum; 4P4D; -.
PDBsum; 4P4E; -.
PDBsum; 4P4F; -.
PDBsum; 4P4I; -.
PDBsum; 4P4J; -.
PDBsum; 4W9Y; -.
PDBsum; 4X3R; -.
PDBsum; 5D29; -.
PDBsum; 5ELY; -.
PDBsum; 5F09; -.
ProteinModelPortal; Q04609; -.
SMR; Q04609; -.
BioGrid; 108630; 4.
IntAct; Q04609; 5.
MINT; MINT-3025010; -.
STRING; 9606.ENSP00000256999; -.
BindingDB; Q04609; -.
ChEMBL; CHEMBL1892; -.
DrugBank; DB06928; (2S)-2-{[HYDROXY(4-IODOBENZYL)PHOSPHORYL]METHYL}PENTANEDIOIC ACID.
DrugBank; DB00089; Capromab.
DrugBank; DB00142; L-Glutamic Acid.
DrugBank; DB07754; N-({(1R)-1-carboxy-2-[(4-fluorobenzyl)sulfanyl]ethyl}carbamoyl)-L-glutamic acid.
GuidetoPHARMACOLOGY; 1606; -.
MEROPS; M28.010; -.
iPTMnet; Q04609; -.
PhosphoSitePlus; Q04609; -.
BioMuta; FOLH1; -.
DMDM; 548615; -.
MaxQB; Q04609; -.
PaxDb; Q04609; -.
PeptideAtlas; Q04609; -.
PRIDE; Q04609; -.
DNASU; 2346; -.
Ensembl; ENST00000256999; ENSP00000256999; ENSG00000086205. [Q04609-1]
Ensembl; ENST00000340334; ENSP00000344131; ENSG00000086205. [Q04609-7]
Ensembl; ENST00000343844; ENSP00000344086; ENSG00000086205. [Q04609-10]
Ensembl; ENST00000356696; ENSP00000349129; ENSG00000086205. [Q04609-8]
Ensembl; ENST00000533034; ENSP00000431463; ENSG00000086205. [Q04609-9]
GeneID; 2346; -.
KEGG; hsa:2346; -.
UCSC; uc001ngy.3; human. [Q04609-1]
CTD; 2346; -.
DisGeNET; 2346; -.
EuPathDB; HostDB:ENSG00000086205.16; -.
GeneCards; FOLH1; -.
H-InvDB; HIX0129475; -.
HGNC; HGNC:3788; FOLH1.
HPA; CAB001451; -.
HPA; HPA010593; -.
MIM; 600934; gene.
neXtProt; NX_Q04609; -.
OpenTargets; ENSG00000086205; -.
PharmGKB; PA28205; -.
eggNOG; KOG2195; Eukaryota.
eggNOG; COG2234; LUCA.
GeneTree; ENSGT00550000074421; -.
HOGENOM; HOG000211921; -.
HOVERGEN; HBG051639; -.
InParanoid; Q04609; -.
KO; K14592; -.
OMA; YVAFQDI; -.
OrthoDB; EOG091G02ZM; -.
PhylomeDB; Q04609; -.
TreeFam; TF312981; -.
BRENDA; 3.4.17.21; 2681.
Reactome; R-HSA-70614; Amino acid synthesis and interconversion (transamination).
EvolutionaryTrace; Q04609; -.
GeneWiki; Glutamate_carboxypeptidase_II; -.
GenomeRNAi; 2346; -.
PRO; PR:Q04609; -.
Proteomes; UP000005640; Chromosome 11.
Bgee; ENSG00000086205; -.
CleanEx; HS_FOLH1; -.
ExpressionAtlas; Q04609; baseline and differential.
Genevisible; Q04609; HS.
GO; GO:0009986; C:cell surface; IDA:BHF-UCL.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell.
GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0016020; C:membrane; TAS:ProtInc.
GO; GO:0005886; C:plasma membrane; IDA:BHF-UCL.
GO; GO:1904492; F:Ac-Asp-Glu binding; IDA:BHF-UCL.
GO; GO:0016805; F:dipeptidase activity; TAS:Reactome.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0004181; F:metallocarboxypeptidase activity; IDA:BHF-UCL.
GO; GO:0008233; F:peptidase activity; NAS:UniProtKB.
GO; GO:1904493; F:tetrahydrofolyl-poly(glutamate) polymer binding; IDA:BHF-UCL.
GO; GO:0035609; P:C-terminal protein deglutamylation; IDA:BHF-UCL.
GO; GO:0008652; P:cellular amino acid biosynthetic process; TAS:Reactome.
GO; GO:0006760; P:folic acid-containing compound metabolic process; IEA:Ensembl.
GO; GO:0006508; P:proteolysis; IDA:BHF-UCL.
Gene3D; 1.20.930.40; -; 1.
InterPro; IPR003137; PA_domain.
InterPro; IPR007484; Peptidase_M28.
InterPro; IPR007365; TFR-like_dimer_dom.
InterPro; IPR036757; TFR-like_dimer_dom_sf.
Pfam; PF02225; PA; 1.
Pfam; PF04389; Peptidase_M28; 1.
Pfam; PF04253; TFR_dimer; 1.
SUPFAM; SSF47672; SSF47672; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Calcium; Carboxypeptidase;
Cell membrane; Complete proteome; Cytoplasm; Dipeptidase;
Direct protein sequencing; Glycoprotein; Hydrolase; Membrane;
Metal-binding; Metalloprotease; Multifunctional enzyme;
Phosphoprotein; Polymorphism; Protease; Reference proteome;
Signal-anchor; Transmembrane; Transmembrane helix; Zinc.
CHAIN 1 750 Glutamate carboxypeptidase 2.
/FTId=PRO_0000174117.
TOPO_DOM 1 19 Cytoplasmic. {ECO:0000305}.
TRANSMEM 20 43 Helical; Signal-anchor for type II
membrane protein. {ECO:0000305}.
TOPO_DOM 44 750 Extracellular. {ECO:0000305}.
REGION 274 587 NAALADase.
REGION 517 518 Substrate binding.
{ECO:0000250|UniProtKB:Q9Y3Q0}.
REGION 534 536 Substrate binding. {ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759}.
REGION 552 553 Substrate binding.
{ECO:0000250|UniProtKB:Q9Y3Q0}.
REGION 699 700 Substrate binding. {ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759}.
COMPBIAS 146 149 Poly-Pro. {ECO:0000255}.
ACT_SITE 424 424 Nucleophile; for NAALADase activity.
ACT_SITE 628 628 Charge relay system. {ECO:0000255}.
ACT_SITE 666 666 Charge relay system. {ECO:0000255}.
ACT_SITE 689 689 Charge relay system. {ECO:0000255}.
METAL 269 269 Calcium. {ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
METAL 272 272 Calcium; via carbonyl oxygen.
{ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
METAL 377 377 Zinc 1; via tele nitrogen; catalytic.
{ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
METAL 387 387 Zinc 1; catalytic. {ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
METAL 387 387 Zinc 2. {ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
METAL 425 425 Zinc 2. {ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
METAL 433 433 Calcium. {ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
METAL 436 436 Calcium. {ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
METAL 453 453 Zinc 1; catalytic. {ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
METAL 553 553 Zinc 2; via tele nitrogen.
{ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
BINDING 210 210 Substrate. {ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
BINDING 257 257 Substrate. {ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
BINDING 424 424 Substrate.
{ECO:0000250|UniProtKB:Q9Y3Q0}.
BINDING 519 519 Substrate. {ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
BINDING 552 552 Substrate. {ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
MOD_RES 10 10 Phosphoserine.
{ECO:0000250|UniProtKB:P70627}.
CARBOHYD 51 51 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:15152093}.
CARBOHYD 76 76 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:12754519,
ECO:0000269|PubMed:15152093,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
CARBOHYD 121 121 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:15152093,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
CARBOHYD 140 140 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:15152093,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
CARBOHYD 153 153 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:1Z8L,
ECO:0000269|PubMed:15152093}.
CARBOHYD 195 195 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:15152093,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
CARBOHYD 336 336 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:12754519,
ECO:0000269|PubMed:15152093}.
CARBOHYD 459 459 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:12754519,
ECO:0000269|PubMed:15152093,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
CARBOHYD 476 476 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:12754519,
ECO:0000269|PubMed:15152093,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
CARBOHYD 638 638 N-linked (GlcNAc...) asparagine.
{ECO:0000244|PDB:1Z8L,
ECO:0000244|PDB:2C6C,
ECO:0000244|PDB:2C6G,
ECO:0000244|PDB:2C6P,
ECO:0000244|PDB:2CIJ,
ECO:0000244|PDB:2JBJ,
ECO:0000244|PDB:2JBK,
ECO:0000244|PDB:2OOT,
ECO:0000244|PDB:2OR4,
ECO:0000244|PDB:2PVV,
ECO:0000244|PDB:2PVW,
ECO:0000244|PDB:2XEF,
ECO:0000244|PDB:2XEG,
ECO:0000244|PDB:2XEI,
ECO:0000244|PDB:2XEJ,
ECO:0000244|PDB:3BHX,
ECO:0000244|PDB:3BI0,
ECO:0000244|PDB:3BI1,
ECO:0000244|PDB:3BXM,
ECO:0000244|PDB:3D7D,
ECO:0000244|PDB:3D7F,
ECO:0000244|PDB:3D7G,
ECO:0000244|PDB:3D7H,
ECO:0000244|PDB:3IWW,
ECO:0000244|PDB:3RBU,
ECO:0000244|PDB:3SJE,
ECO:0000244|PDB:3SJF,
ECO:0000244|PDB:3SJG,
ECO:0000244|PDB:3SJX,
ECO:0000244|PDB:4JYW,
ECO:0000244|PDB:4JZ0,
ECO:0000244|PDB:4LQG,
ECO:0000244|PDB:4MCP,
ECO:0000244|PDB:4MCQ,
ECO:0000244|PDB:4MCR,
ECO:0000244|PDB:4MCS,
ECO:0000244|PDB:4NGM,
ECO:0000244|PDB:4NGN,
ECO:0000244|PDB:4NGP,
ECO:0000244|PDB:4NGQ,
ECO:0000244|PDB:4NGR,
ECO:0000244|PDB:4NGS,
ECO:0000244|PDB:4NGT,
ECO:0000244|PDB:4OC0,
ECO:0000244|PDB:4OC1,
ECO:0000244|PDB:4OC2,
ECO:0000244|PDB:4OC3,
ECO:0000244|PDB:4OC4,
ECO:0000244|PDB:4OC5,
ECO:0000244|PDB:4OME,
ECO:0000244|PDB:4P44,
ECO:0000244|PDB:4P45,
ECO:0000244|PDB:4P4B,
ECO:0000244|PDB:4P4D,
ECO:0000244|PDB:4P4E,
ECO:0000244|PDB:4P4F,
ECO:0000244|PDB:4P4I,
ECO:0000244|PDB:4P4J,
ECO:0000269|PubMed:12754519,
ECO:0000269|PubMed:15152093,
ECO:0000269|PubMed:16467855,
ECO:0000269|PubMed:17372356,
ECO:0000269|PubMed:17567119,
ECO:0000269|PubMed:18234225,
ECO:0000269|PubMed:19053759,
ECO:0000269|PubMed:19301871}.
VAR_SEQ 1 585 Missing (in isoform PSMA-3).
{ECO:0000305}.
/FTId=VSP_040242.
VAR_SEQ 1 308 Missing (in isoform 10).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_044287.
VAR_SEQ 1 159 Missing (in isoform PSMA-4).
{ECO:0000305}.
/FTId=VSP_040241.
VAR_SEQ 1 57 Missing (in isoform PSMA').
{ECO:0000303|PubMed:7882349}.
/FTId=VSP_005336.
VAR_SEQ 1 39 MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLF
-> MTAGSSYPLFLAAYACTGCLAERL (in isoform
PSMA-7 and isoform PSMA-9).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:17929272}.
/FTId=VSP_038058.
VAR_SEQ 214 243 VKNAQLAGAKGVILYSDPADYFAPGVKSYP -> NMLIGVE
LQRLLVFQVFLFIQLDTMMHRSS (in isoform PSMA-
4). {ECO:0000305}.
/FTId=VSP_040243.
VAR_SEQ 244 750 Missing (in isoform PSMA-4).
{ECO:0000305}.
/FTId=VSP_040244.
VAR_SEQ 657 750 NPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSH
NKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFT
VQAAAETLSEVA -> MSSMLQAATTSMQGSHSQEFMMLCL
ILKAKWTLPRPGEK (in isoform PSMA-3).
{ECO:0000305}.
/FTId=VSP_040245.
VAR_SEQ 657 688 NPIVLRMMNDQLMFLERAFIDPLGLPDRPFYR -> K (in
isoform PSMA-8 and isoform PSMA-9).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:17929272,
ECO:0000303|Ref.10}.
/FTId=VSP_038059.
VARIANT 23 23 A -> T (in a colorectal cancer sample;
somatic mutation).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036398.
VARIANT 75 75 Y -> H (in dbSNP:rs202676).
{ECO:0000269|PubMed:9838072}.
/FTId=VAR_024592.
VARIANT 475 475 H -> Y (can be associated with lower
folate and higher homocysteine levels;
dbSNP:rs61886492).
{ECO:0000269|PubMed:11092759}.
/FTId=VAR_012736.
VARIANT 627 627 V -> L (in dbSNP:rs2988342).
/FTId=VAR_028882.
MUTAGEN 51 51 N->A: Loss of glycosylation. Reduces
enzyme activity.
{ECO:0000269|PubMed:15152093}.
MUTAGEN 76 76 N->A: Loss of glycosylation. Reduces
enzyme activity.
{ECO:0000269|PubMed:15152093}.
MUTAGEN 121 121 N->A: Loss of glycosylation. Severely
reduced enzyme activity.
{ECO:0000269|PubMed:15152093}.
MUTAGEN 140 140 N->A: Loss of glycosylation. Severely
reduced enzyme activity.
{ECO:0000269|PubMed:15152093}.
MUTAGEN 153 153 N->A: Loss of glycosylation. Severely
reduced enzyme activity.
{ECO:0000269|PubMed:15152093}.
MUTAGEN 195 195 N->A: Loss of glycosylation. Severely
reduced enzyme activity.
{ECO:0000269|PubMed:15152093}.
MUTAGEN 336 336 N->A: Loss of glycosylation. Reduces
enzyme activity.
{ECO:0000269|PubMed:15152093}.
MUTAGEN 377 377 H->A,G,Q: Complete loss of activity.
{ECO:0000269|PubMed:9882712}.
MUTAGEN 379 379 D->E,N: Complete loss of activity.
{ECO:0000269|PubMed:9882712}.
MUTAGEN 387 387 D->E,L: Complete loss of activity.
{ECO:0000269|PubMed:9882712}.
MUTAGEN 387 387 D->N: No effect on enzyme activity.
{ECO:0000269|PubMed:9882712}.
MUTAGEN 388 388 P->A: No effect on enzyme activity.
{ECO:0000269|PubMed:9882712}.
MUTAGEN 424 424 E->A: Complete loss of activity.
{ECO:0000269|PubMed:19301871}.
MUTAGEN 424 424 E->D: Reduces enzyme activity.
{ECO:0000269|PubMed:19301871}.
MUTAGEN 424 424 E->Q: Reduces enzyme activity.
{ECO:0000269|PubMed:19301871}.
MUTAGEN 425 425 E->Q,D: Complete loss of activity.
{ECO:0000269|PubMed:9882712}.
MUTAGEN 453 453 D->N,L: Complete loss of activity.
{ECO:0000269|PubMed:9882712}.
MUTAGEN 453 453 D->Q: Reduces enzyme activity.
{ECO:0000269|PubMed:9882712}.
MUTAGEN 454 454 S->A: Reduces enzyme activity.
{ECO:0000269|PubMed:9882712}.
MUTAGEN 459 459 N->A: Loss of glycosylation. Reduces
enzyme activity.
{ECO:0000269|PubMed:15152093}.
MUTAGEN 476 476 N->A: Loss of glycosylation. Reduces
enzyme activity.
{ECO:0000269|PubMed:15152093}.
MUTAGEN 638 638 N->A: Loss of glycosylation. Abolishes
enzyme activity.
{ECO:0000269|PubMed:15152093}.
MUTAGEN 640 640 T->A: Abolishes enzyme activity.
{ECO:0000269|PubMed:15152093}.
CONFLICT 194 194 I -> V (in Ref. 9; AAZ66619).
{ECO:0000305}.
CONFLICT 354 354 R -> K (in Ref. 1; AA sequence).
{ECO:0000305}.
CONFLICT 398 398 I -> N (in Ref. 8; ABO93402).
{ECO:0000305}.
HELIX 58 64 {ECO:0000244|PDB:3BI1}.
HELIX 67 77 {ECO:0000244|PDB:3BI1}.
STRAND 78 80 {ECO:0000244|PDB:3BI1}.
HELIX 87 103 {ECO:0000244|PDB:3BI1}.
STRAND 106 119 {ECO:0000244|PDB:3BI1}.
STRAND 122 124 {ECO:0000244|PDB:2C6G}.
STRAND 127 131 {ECO:0000244|PDB:3BI1}.
STRAND 137 140 {ECO:0000244|PDB:3BI1}.
TURN 149 151 {ECO:0000244|PDB:3D7H}.
HELIX 154 156 {ECO:0000244|PDB:3IWW}.
STRAND 174 176 {ECO:0000244|PDB:3BI1}.
HELIX 182 190 {ECO:0000244|PDB:3BI1}.
STRAND 200 204 {ECO:0000244|PDB:3BI1}.
HELIX 210 219 {ECO:0000244|PDB:3BI1}.
STRAND 223 228 {ECO:0000244|PDB:3BI1}.
HELIX 231 234 {ECO:0000244|PDB:3BI1}.
STRAND 244 247 {ECO:0000244|PDB:3BI1}.
STRAND 269 272 {ECO:0000244|PDB:1Z8L}.
HELIX 283 285 {ECO:0000244|PDB:3BI1}.
STRAND 294 297 {ECO:0000244|PDB:3BI1}.
HELIX 299 306 {ECO:0000244|PDB:3BI1}.
HELIX 317 319 {ECO:0000244|PDB:3BI1}.
STRAND 322 325 {ECO:0000244|PDB:3BI1}.
STRAND 330 333 {ECO:0000244|PDB:3BI1}.
HELIX 335 337 {ECO:0000244|PDB:3BI1}.
STRAND 341 346 {ECO:0000244|PDB:3BI1}.
STRAND 349 362 {ECO:0000244|PDB:3BI1}.
STRAND 365 377 {ECO:0000244|PDB:3BI1}.
STRAND 381 383 {ECO:0000244|PDB:3D7F}.
TURN 385 388 {ECO:0000244|PDB:3BI1}.
HELIX 389 407 {ECO:0000244|PDB:3BI1}.
STRAND 413 423 {ECO:0000244|PDB:3BI1}.
HELIX 424 426 {ECO:0000244|PDB:3BI1}.
HELIX 429 445 {ECO:0000244|PDB:3BI1}.
STRAND 446 451 {ECO:0000244|PDB:3BI1}.
STRAND 455 457 {ECO:0000244|PDB:3BI1}.
STRAND 459 466 {ECO:0000244|PDB:3BI1}.
HELIX 468 470 {ECO:0000244|PDB:3BI1}.
HELIX 471 479 {ECO:0000244|PDB:3BI1}.
STRAND 480 482 {ECO:0000244|PDB:3D7H}.
TURN 486 490 {ECO:0000244|PDB:2JBK}.
HELIX 493 500 {ECO:0000244|PDB:3BI1}.
STRAND 504 506 {ECO:0000244|PDB:3BI1}.
STRAND 507 510 {ECO:0000244|PDB:4NGP}.
STRAND 517 519 {ECO:0000244|PDB:3BI1}.
HELIX 521 526 {ECO:0000244|PDB:3BI1}.
STRAND 531 538 {ECO:0000244|PDB:3BI1}.
STRAND 541 543 {ECO:0000244|PDB:3BI1}.
TURN 545 547 {ECO:0000244|PDB:3D7H}.
TURN 550 553 {ECO:0000244|PDB:3BI1}.
HELIX 559 565 {ECO:0000244|PDB:3BI1}.
HELIX 571 589 {ECO:0000244|PDB:3BI1}.
HELIX 597 615 {ECO:0000244|PDB:3BI1}.
HELIX 619 624 {ECO:0000244|PDB:3BI1}.
HELIX 630 652 {ECO:0000244|PDB:3BI1}.
HELIX 658 673 {ECO:0000244|PDB:3BI1}.
STRAND 684 686 {ECO:0000244|PDB:1Z8L}.
STRAND 689 695 {ECO:0000244|PDB:3BI1}.
STRAND 698 705 {ECO:0000244|PDB:3BI1}.
HELIX 706 712 {ECO:0000244|PDB:3BI1}.
HELIX 715 717 {ECO:0000244|PDB:3BI1}.
HELIX 721 744 {ECO:0000244|PDB:3BI1}.
SEQUENCE 750 AA; 84331 MW; AD8C0A7DBF47901A CRC64;
MWNLLHETDS AVATARRPRW LCAGALVLAG GFFLLGFLFG WFIKSSNEAT NITPKHNMKA
FLDELKAENI KKFLYNFTQI PHLAGTEQNF QLAKQIQSQW KEFGLDSVEL AHYDVLLSYP
NKTHPNYISI INEDGNEIFN TSLFEPPPPG YENVSDIVPP FSAFSPQGMP EGDLVYVNYA
RTEDFFKLER DMKINCSGKI VIARYGKVFR GNKVKNAQLA GAKGVILYSD PADYFAPGVK
SYPDGWNLPG GGVQRGNILN LNGAGDPLTP GYPANEYAYR RGIAEAVGLP SIPVHPIGYY
DAQKLLEKMG GSAPPDSSWR GSLKVPYNVG PGFTGNFSTQ KVKMHIHSTN EVTRIYNVIG
TLRGAVEPDR YVILGGHRDS WVFGGIDPQS GAAVVHEIVR SFGTLKKEGW RPRRTILFAS
WDAEEFGLLG STEWAEENSR LLQERGVAYI NADSSIEGNY TLRVDCTPLM YSLVHNLTKE
LKSPDEGFEG KSLYESWTKK SPSPEFSGMP RISKLGSGND FEVFFQRLGI ASGRARYTKN
WETNKFSGYP LYHSVYETYE LVEKFYDPMF KYHLTVAQVR GGMVFELANS IVLPFDCRDY
AVVLRKYADK IYSISMKHPQ EMKTYSVSFD SLFSAVKNFT EIASKFSERL QDFDKSNPIV
LRMMNDQLMF LERAFIDPLG LPDRPFYRHV IYAPSSHNKY AGESFPGIYD ALFDIESKVD
PSKAWGEVKR QIYVAAFTVQ AAAETLSEVA


Related products :

Catalog number Product name Quantity
20-272-191781 PSMA - Mouse monoclonal [YPSMA-1] to PSMA; EC 3.4.17.21; Glutamate carboxypeptidase II; Membrane glutamate carboxypeptidase; mGCP; N-acetylated-alpha-linked acidic dipeptidase I; NAALADase I; Pteroylp 0.25 mg
EIAAB26326 GCPIII,Glutamate carboxypeptidase III,Homo sapiens,Human,NAALAD2,NAALADase II,N-acetylated-alpha-linked acidic dipeptidase 2,N-acetylated-alpha-linked acidic dipeptidase II
EIAAB26325 GCPIII,Glutamate carboxypeptidase III,Mouse,Mus musculus,NAAG-peptidase II,Naalad2,NAALADase II,N-acetylaspartylglutamate peptidase II,N-acetylated-alpha-linked acidic dipeptidase 2,N-acetylated-alpha
EIAAB08161 Cn2,CNDP dipeptidase 2,Cndp2,Cytosolic non-specific dipeptidase,Glutamate carboxypeptidase-like protein 1,Mouse,Mus musculus
EIAAB08159 CN2,CNDP dipeptidase 2,CNDP2,CPGL,Cytosolic non-specific dipeptidase,Glutamate carboxypeptidase-like protein 1,Homo sapiens,Human,PEPA,Peptidase A
EIAAB08156 Beta-Ala-His dipeptidase,Carnosine dipeptidase 1,CN1,CNDP dipeptidase 1,CNDP1,CPGL2,Glutamate carboxypeptidase-like protein 2,Homo sapiens,Human,Serum carnosinase,UNQ1915_PRO4380
20-272-191095 Carboxypeptidase B2 - Mouse monoclonal [15A10] to Carboxypeptidase B2; EC 3.4.17.20; Carboxypeptidase U; CPU; Thrombin-activable fibrinolysis inhibitor; TAFI; Plasma carboxypeptidase B; pCPB Monoclona 0.2 mg
EIAAB09070 ACBP,Carboxypeptidase N 83 kDa chain,Carboxypeptidase N large subunit,Carboxypeptidase N polypeptide 2,Carboxypeptidase N regulatory subunit,Carboxypeptidase N subunit 2,CPN2,Homo sapiens,Human
25-996 FOLH1 is a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate 0.05 mg
EIAAB05608 ACBP,Anaphylatoxin inactivator,Arginine carboxypeptidase,Carboxypeptidase N catalytic chain,Carboxypeptidase N polypeptide 1,Carboxypeptidase N small subunit,CPN,CPN1,Homo sapiens,Human,Kininase-1,Lys
PE117274h Recombinant human Glutamate carboxypeptidase 2 protein 5mg
PE117274h Recombinant human Glutamate carboxypeptidase 2 protein 50ug
PE117274h Recombinant human Glutamate carboxypeptidase 2 protein 1mg
PE117274h Recombinant human Glutamate carboxypeptidase 2 protein 200ug
EIAAB09069 Carboxypeptidase N 83 kDa chain,Carboxypeptidase N large subunit,Carboxypeptidase N polypeptide 2,Carboxypeptidase N regulatory subunit,Carboxypeptidase N subunit 2,Cpn2,Mouse,Mus musculus
FOLH1_MOUSE ELISA Kit FOR Glutamate carboxypeptidase 2; organism: Mouse; gene name: Folh1 96T
PGCP_RAT ELISA Kit FOR Plasma glutamate carboxypeptidase; organism: Rat; gene name: Pgcp 96T
FOLH1_PIG Pig ELISA Kit FOR Glutamate carboxypeptidase 2 96T
FOLH1_RAT Rat ELISA Kit FOR Glutamate carboxypeptidase 2 96T
PGCP_MOUSE ELISA Kit FOR Plasma glutamate carboxypeptidase; organism: Mouse; gene name: Pgcp 96T
CSB-EL008782RA Rat Glutamate carboxypeptidase 2(FOLH1) ELISA kit 96T
E9708h Human Glutamate Carboxypeptidase II ELISA Kit 96T
CSB-RP117294h Recombinant human Glutamate carboxypeptidase 2 500ug
20-272-191094 Carboxypeptidase B2 - Mouse monoclonal [13H4] to Carboxypeptidase B2; EC 3.4.17.20; Carboxypeptidase U; CPU; Thrombin-activable fibrinolysis inhibitor; TAFI; Plasma carboxypeptidase B; pCPB Monoclonal 0.2 mg
20-272-191097 Carboxypeptidase B2 - Mouse monoclonal [16C5] to Carboxypeptidase B2; EC 3.4.17.20; Carboxypeptidase U; CPU; Thrombin-activable fibrinolysis inhibitor; TAFI; Plasma carboxypeptidase B; pCPB Monoclonal 0.2 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur